LGKVKSLTISFDCLNNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWTESRNTAYTQNYTEEVEYFNHKDIL
IGHFHTIHSGRHEYAFSFELPQTPLATSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDINTPS
The query sequence (length=150) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4r7x:A | 150 | 150 | 1.0000 | 1.0000 | 1.0000 | 5.99e-111 | 4r7x:B |
2 | 4gej:E | 142 | 146 | 0.3933 | 0.4155 | 0.4041 | 6.28e-27 | 4gej:A, 4gej:F, 4gej:C, 4gej:J, 4gej:B, 4gej:D, 4gej:H, 4gej:I |
3 | 4ig6:A | 223 | 56 | 0.0933 | 0.0628 | 0.2500 | 1.6 | |
4 | 8wd8:A | 750 | 41 | 0.1067 | 0.0213 | 0.3902 | 3.8 | 8jsi:A, 8jsi:B, 8wd8:B |
5 | 4u3e:A | 637 | 38 | 0.1000 | 0.0235 | 0.3947 | 3.8 | 4coi:A, 4coi:B, 4coj:A, 4coj:B, 4col:A, 4col:B, 4com:A, 4com:B, 4u3e:B |
6 | 8rta:E | 169 | 46 | 0.1000 | 0.0888 | 0.3261 | 6.2 | |
7 | 8a5a:U | 690 | 19 | 0.0667 | 0.0145 | 0.5263 | 7.3 | 8a5o:U, 4am7:A, 4am7:B |
8 | 1p1i:B | 498 | 29 | 0.0867 | 0.0261 | 0.4483 | 8.0 | 1p1h:B, 1p1h:D |
9 | 1jki:A | 525 | 29 | 0.0867 | 0.0248 | 0.4483 | 8.0 | 1jki:B, 1la2:A, 1la2:B, 1la2:C, 1la2:D, 1p1h:A, 1p1h:C, 1p1i:A, 1p1j:A, 1p1j:B, 1p1k:A, 1p1k:B, 1rm0:A, 1rm0:B |
10 | 1jkf:A | 466 | 29 | 0.0867 | 0.0279 | 0.4483 | 8.2 | 1jkf:B |
11 | 7ogp:D | 510 | 63 | 0.1333 | 0.0392 | 0.3175 | 8.5 | |
12 | 8que:D | 654 | 63 | 0.1333 | 0.0306 | 0.3175 | 8.8 | 7ogr:D |