LEYPIGTPQNLAGMEIAAVYLQPIDMEPEGHMRKASESDIHIEADIHALSNNPNGYPEGFWVPFLFIKYEITKVGGSGAP
ITGDMMAMVASDGPHYGDNVKLQGPGKYKVKYTIYPPNAKENPMSPYYGRHTDRETGVRPWFKTFSVEWDFTYAGI
The query sequence (length=156) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7r5e:B | 157 | 156 | 1.0000 | 0.9936 | 1.0000 | 9.66e-116 | 7r4v:B, 7r4v:A, 7r4z:A, 7r4z:B, 7r5e:A, 7r5g:A, 7r5g:B, 7r5p:A, 7r5p:B, 7r5p:C, 7r5p:D, 7r5p:E, 7r5p:F |
2 | 5i0v:A | 159 | 161 | 0.5449 | 0.5346 | 0.5280 | 4.47e-51 | 5i0v:B, 5i0w:A, 5i0w:B, 3lzl:A, 3lzl:B, 3lzn:A, 3lzn:B, 3lzo:A, 3lzo:B, 3lzp:A, 3lzp:B, 3lzq:A, 3lzq:B, 3lzr:A, 3lzr:B, 6wed:A, 6wed:B, 6wee:A, 6wee:B, 6wee:C, 6wee:D, 6wee:E, 6wee:F, 6wef:C, 6wef:D, 6wef:A, 6wef:B, 6wef:E, 6wef:F, 6wef:G, 6wef:H, 6wef:I, 6wef:J, 6wef:K, 6wef:L |
3 | 5i0x:B | 158 | 155 | 0.4872 | 0.4810 | 0.4903 | 7.51e-46 | 5i0x:A, 5i0y:A, 5i0y:B, 3nrq:A, 3nrq:B |
4 | 8t7m:B | 160 | 159 | 0.4487 | 0.4375 | 0.4403 | 1.39e-31 | 8t7l:A, 8t7l:B, 8t7m:A |
5 | 2o6d:A | 158 | 161 | 0.4038 | 0.3987 | 0.3913 | 2.32e-23 | 2o6d:B, 2o6e:A, 2o6e:B, 3pjl:A, 3pjl:B, 3pjn:A, 3pjn:B |
6 | 4a69:A | 369 | 64 | 0.1282 | 0.0542 | 0.3125 | 0.64 | 4a69:B |
7 | 6j38:A | 368 | 37 | 0.0897 | 0.0380 | 0.3784 | 4.5 | 6j38:B, 6j39:A, 6j39:B |
8 | 7fgx:D | 563 | 34 | 0.1026 | 0.0284 | 0.4706 | 5.7 | 7fgw:A, 7fgw:B, 7fgw:C, 7fgw:D, 7fgx:A, 7fgx:B, 7fgx:C, 7fgy:A, 7fgy:B, 7fgy:C, 7fgy:D |
9 | 3dwb:A | 660 | 20 | 0.0641 | 0.0152 | 0.5000 | 7.8 | |
10 | 6mea:A | 162 | 56 | 0.0962 | 0.0926 | 0.2679 | 8.0 | 6mea:B, 6meb:A, 6meb:B, 6men:A, 6men:B |