Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 1wii:A 85 62 0.9375 0.7059 0.9677 2.05e-42 8b3d:M, 8b3f:M
2 8he5:M 64 60 0.5156 0.5156 0.5500 5.54e-21 6ir9:M, 6j4w:M, 6j4x:M, 6j4y:M, 6j51:M, 8jh2:M, 7wbv:M, 7wbx:M, 7xn7:M, 5xog:M, 7xse:M, 7xsx:M, 7xsz:M, 7xt7:M, 7xtd:M, 7xti:M
3 3q45:A 368 27 0.1406 0.0245 0.3333 0.65 3q45:B, 3q45:C, 3q45:D, 3q45:E, 3q45:F, 3q45:G, 3q45:H, 3q45:I, 3q4d:A, 3q4d:B, 3q4d:C, 3q4d:D, 3q4d:E, 3q4d:F, 3q4d:G, 3q4d:H, 3q4d:I
4 2bgg:B 394 33 0.1875 0.0305 0.3636 1.6 2w42:B
5 8ok9:A 430 33 0.1875 0.0279 0.3636 1.6 2bgg:A, 8pvv:A, 8qg0:A, 6t5t:A, 6tuo:A, 2w42:A, 6xu0:A, 6xu0:B, 6xup:A, 6xup:B, 1ytu:A, 1ytu:B
6 5eya:G 86 15 0.1250 0.0930 0.5333 2.9 5eya:F, 5fer:A, 5fer:D
7 7she:A 541 24 0.1406 0.0166 0.3750 3.4 7she:B, 7shf:B
8 4oev:A 494 47 0.2188 0.0283 0.2979 6.1 4oeu:A, 4oeu:B, 4oev:B
9 1a7d:A 118 50 0.2344 0.1271 0.3000 7.4 1a7e:A, 2mhr:A
10 8y6o:I 597 36 0.2031 0.0218 0.3611 8.0 8qp8:G, 6qw6:5X, 6qx9:5X, 8r08:G
11 6ra0:A 138 22 0.1406 0.0652 0.4091 9.3

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218