LENCLGVQKIAPEQIRQLFAQTSEYHFSIPAKTEEKSNLNVFFGEGRRDKRGFVKPRPWYEVELIVSKDITSQEGYPVLK
SFTVITDDGWQFQCKTSGDYSKNFRSENDLKTLGKWIKGRLESHGCLQNNEKITHETLREYGNDHFELRSTDNPDVWLLS
FKGK
The query sequence (length=164) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4rdm:A | 165 | 164 | 1.0000 | 0.9939 | 1.0000 | 1.09e-122 | 4rd5:A, 4rd5:B, 4rdm:B |
2 | 5nem:2 | 214 | 87 | 0.1524 | 0.1168 | 0.2874 | 0.87 | |
3 | 4z5q:A | 363 | 80 | 0.1280 | 0.0579 | 0.2625 | 1.2 | |
4 | 6n2c:A | 409 | 30 | 0.0671 | 0.0269 | 0.3667 | 3.7 | 6n2c:B |
5 | 7cm9:A | 693 | 37 | 0.0915 | 0.0216 | 0.4054 | 5.4 | 7cm9:B, 7cm9:C, 7cm9:D |
6 | 7aoi:XA | 154 | 92 | 0.1220 | 0.1299 | 0.2174 | 5.5 | 6yxx:EG, 6yxy:EG |
7 | 4x4o:C | 443 | 48 | 0.1037 | 0.0384 | 0.3542 | 7.0 | 2dr5:A, 2dr7:A, 2dr8:A, 2dr9:A, 2dra:A, 2drb:A, 2dvi:A, 3ouy:A, 3ouy:B, 3ov7:A, 3ov7:B, 3ova:A, 3ovb:A, 3ovb:B, 3ovs:A, 3ovs:B, 1r89:A, 1r8a:A, 1r8b:A, 1r8c:A, 1sz1:A, 1sz1:B, 1tfw:B, 1tfw:D, 1tfw:A, 1tfw:C, 1tfy:B, 1tfy:D, 1tfy:A, 1tfy:C, 1uet:A, 1ueu:A, 1uev:A, 4x4n:E, 4x4n:F, 4x4n:A, 4x4n:C, 4x4o:A, 4x4p:A, 4x4p:C, 4x4p:E, 4x4p:G, 4x4q:A, 4x4q:C, 4x4r:A, 4x4r:C, 4x4s:A, 4x4s:C, 4x4t:A, 4x4t:C, 4x4t:E, 4x4t:F, 4x4u:A, 4x4u:C, 4x4u:E, 4x4u:F, 4x4v:A, 4x4v:C, 2zh1:A, 2zh2:A, 2zh3:A, 2zh4:A, 2zh5:A, 2zh6:A, 2zh7:A, 2zh8:A, 2zh9:A, 2zha:A, 2zhb:A |