BioLiP

>protein
LENCLGVQKIAPEQIRQLFAQTSEYHFSIPAKTEEKSNLNVFFGEGRRDKRGFVKPRPWYEVELIVSKDITSQEGYPVLK
SFTVITDDGWQFQCKTSGDYSKNFRSENDLKTLGKWIKGRLESHGCLQNNEKITHETLREYGNDHFELRSTDNPDVWLLS
FKGK

The query sequence (length=164) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4rdm:A	165	164	1.0000	0.9939	1.0000	1.09e-122	4rd5:A, 4rd5:B, 4rdm:B
2	5nem:2	214	87	0.1524	0.1168	0.2874	0.87
3	4z5q:A	363	80	0.1280	0.0579	0.2625	1.2
4	6n2c:A	409	30	0.0671	0.0269	0.3667	3.7	6n2c:B
5	7cm9:A	693	37	0.0915	0.0216	0.4054	5.4	7cm9:B, 7cm9:C, 7cm9:D
6	7aoi:XA	154	92	0.1220	0.1299	0.2174	5.5	6yxx:EG, 6yxy:EG
7	4x4o:C	443	48	0.1037	0.0384	0.3542	7.0	2dr5:A, 2dr7:A, 2dr8:A, 2dr9:A, 2dra:A, 2drb:A, 2dvi:A, 3ouy:A, 3ouy:B, 3ov7:A, 3ov7:B, 3ova:A, 3ovb:A, 3ovb:B, 3ovs:A, 3ovs:B, 1r89:A, 1r8a:A, 1r8b:A, 1r8c:A, 1sz1:A, 1sz1:B, 1tfw:B, 1tfw:D, 1tfw:A, 1tfw:C, 1tfy:B, 1tfy:D, 1tfy:A, 1tfy:C, 1uet:A, 1ueu:A, 1uev:A, 4x4n:E, 4x4n:F, 4x4n:A, 4x4n:C, 4x4o:A, 4x4p:A, 4x4p:C, 4x4p:E, 4x4p:G, 4x4q:A, 4x4q:C, 4x4r:A, 4x4r:C, 4x4s:A, 4x4s:C, 4x4t:A, 4x4t:C, 4x4t:E, 4x4t:F, 4x4u:A, 4x4u:C, 4x4u:E, 4x4u:F, 4x4v:A, 4x4v:C, 2zh1:A, 2zh2:A, 2zh3:A, 2zh4:A, 2zh5:A, 2zh6:A, 2zh7:A, 2zh8:A, 2zh9:A, 2zha:A, 2zhb:A

[Back]