BioLiP

>protein
LEDLKQQLQQAEEALVAKQEVIDKLCEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQRE
YSK

The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4owf:B	86	83	0.9036	0.8721	0.9036	4.11e-45	9azj:A, 9azj:B, 4owf:A, 7tv4:B, 7tv4:D
2	9b0z:A	89	68	0.3373	0.3146	0.4118	2.73e-09	9b0b:A, 9b0b:B, 9b0b:C, 9b0b:D, 9b0z:B, 9b12:C, 9b12:D, 9b12:E, 9b12:F
3	1ksf:X	714	62	0.2289	0.0266	0.3065	1.5	1mbu:A, 1mbu:B, 1mbx:A, 1mbx:B, 1r6b:X, 1r6o:A, 1r6o:B, 1r6q:A, 1r6q:B, 7uiv:B, 7uiv:C, 7uiv:D, 7uiv:E, 7uiv:A, 7uiv:F, 7uiw:A, 7uiw:B, 7uiw:C, 7uiw:D, 7uiw:E, 7uix:B, 7uix:C, 7uix:D, 7uix:E, 7uix:F, 7uix:A, 7uiy:B, 7uiy:C, 7uiy:D, 7uiy:E, 7uiy:A, 7uiy:F, 7uiz:B, 7uiz:C, 7uiz:D, 7uiz:E, 7uiz:A, 7uiz:F, 7uj0:B, 7uj0:C, 7uj0:D, 7uj0:E, 7uj0:A, 7uj0:F, 6uqe:A, 6uqe:B, 6uqe:C, 6uqe:D, 6uqe:E, 6uqe:F, 6uqo:C, 6uqo:D, 6uqo:A, 6uqo:B, 6uqo:E, 6uqo:F, 6w1z:A, 6w1z:B, 6w1z:C, 6w1z:D, 6w1z:E, 6w1z:F, 6w20:A, 6w20:B, 6w20:C, 6w20:D, 6w20:E, 6w20:F, 6w21:A, 6w21:B, 6w21:C, 6w21:D, 6w21:E, 6w21:F, 6w22:A, 6w22:B, 6w22:C, 6w22:D, 6w22:E, 6w22:F, 6w23:A, 6w23:B, 6w23:C, 6w23:D, 6w23:E, 6w23:F, 6w24:A, 6w24:B, 6w24:C, 6w24:D, 6w24:E, 6w24:F
4	6hns:A	443	26	0.1446	0.0271	0.4615	6.9	6hns:B
5	8pmq:2	355	40	0.1566	0.0366	0.3250	8.4	7ns4:b

[Back]