LEAQQQLANSEVHGQAGGGLVKVVVKGSGEVIGVTIDPKVVDPDDIETLQDLIVGAMRDASQQVTKMAQER
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5yrx:A | 71 | 71 | 1.0000 | 1.0000 | 1.0000 | 4.34e-45 | |
2 | 2gyq:A | 162 | 25 | 0.1690 | 0.0741 | 0.4800 | 0.95 | 2gyq:B |
3 | 6x1u:L | 213 | 42 | 0.1972 | 0.0657 | 0.3333 | 2.1 | 6x1u:B |
4 | 1vh2:A | 152 | 19 | 0.1408 | 0.0658 | 0.5263 | 2.2 | 1inn:A, 1inn:B, 1j6v:A, 1vgx:A, 1vgx:B, 1vje:A, 1vje:B |
5 | 6ytt:C | 630 | 35 | 0.2254 | 0.0254 | 0.4571 | 5.1 | 6ytt:B, 6yu9:A, 6yu9:B, 6yu9:C, 6yu9:D, 6yua:B, 6yua:C |
6 | 7c9m:C | 260 | 50 | 0.2113 | 0.0577 | 0.3000 | 5.2 | 7c7m:A, 7c9m:A, 7c9m:B, 7c9m:D |
7 | 1j6w:A | 161 | 21 | 0.1268 | 0.0559 | 0.4286 | 7.1 | 1j6w:B, 1joe:A, 1joe:B, 1joe:C, 1joe:D |
8 | 2j51:A | 288 | 44 | 0.1972 | 0.0486 | 0.3182 | 8.7 | 8bem:A, 8bem:B, 8bem:D, 8bem:G, 6hvd:A, 2jfl:A, 4usf:A, 4usf:B, 2uv2:A |
9 | 6c95:B | 160 | 46 | 0.1549 | 0.0688 | 0.2391 | 9.0 | 6ppl:C, 6pw9:C |
10 | 8iof:C | 792 | 52 | 0.2113 | 0.0189 | 0.2885 | 9.2 | 8iof:A, 8iof:B, 8iof:D |