BioLiP

>protein
LDVPSSSRYDHRIRYVTYNPADVVQVDTVLGVATHIMLEEGEQYLTHAFGDSEAYAFARKGRHIFIKPQAELANTNLIVV
TDRRSYKFRLQMRNDRNGAMYELAFRYPDTQARQT

The query sequence (length=115) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8rt6:B	246	115	1.0000	0.4675	1.0000	2.18e-82	7o3j:B, 7o3j:E, 7o3j:H, 7o3j:K, 7o3j:N, 7o3j:Q, 7o3j:T, 7o3j:W, 7o3j:Z, 7o3j:c, 7o3j:f, 7o3j:i, 7o3j:l, 7o3j:o, 7o3t:B, 7o3t:z, 7o3t:E, 7o3t:H, 7o3t:K, 7o3t:N, 7o3t:Q, 7o3t:T, 7o3t:v, 7o3t:W, 7o3t:Z, 7o3t:c, 7o3t:f, 7o3t:i, 7o3t:l, 7o3t:o, 8rt4:B, 8rt4:E, 8rt4:H, 8rt4:K, 8rt4:N, 8rt4:Q, 8rt4:T, 8rt4:W, 8rt4:Z, 8rt4:c, 8rt4:f, 8rt4:i, 8rt4:l, 8rt4:o, 8rt5:B, 8rt5:z, 8rt5:E, 8rt5:H, 8rt5:K, 8rt5:N, 8rt5:Q, 8rt5:T, 8rt5:v, 8rt5:W, 8rt5:Z, 8rt5:c, 8rt5:f, 8rt5:i, 8rt5:l, 8rt5:o, 8rt6:E, 8rt6:H, 8rt6:K, 8rt6:N, 8rt6:Q, 8rt6:T, 8rt6:W, 8rt6:Z, 8rt6:c, 8rt6:f, 8rt6:i, 8rt6:l, 8rt6:o, 8rt6:v, 8rt6:z, 8rt7:B, 8rt7:E, 8rt7:H, 8rt7:K, 8rt7:N, 8rt7:Q, 8rt7:T, 8rt7:W, 8rt7:Z, 8rt7:c, 8rt7:f, 8rt7:i, 8rt7:l, 8rt7:o, 8rt7:v, 8rt7:z, 8rt8:B, 8rt8:E, 8rt8:H, 8rt8:K, 8rt8:N, 8rt8:Q, 8rt8:T, 8rt8:W, 8rt8:Z, 8rt8:c, 8rt8:f, 8rt8:i, 8rt8:l, 8rt8:o, 8rt8:v, 8rt8:z
2	3tvq:A	152	37	0.1217	0.0921	0.3784	0.94
3	7xt2:B	388	48	0.1391	0.0412	0.3333	4.0	7xt2:A

[Back]