LDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQKNSTIFATNDPAGFNIIDVAGWGALGHAVG
FAVLAINSLQG
The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7zq9:G | 95 | 91 | 1.0000 | 0.9579 | 1.0000 | 2.58e-62 | 7d0j:G, 7dz7:G, 7dz8:G, 8h2u:G, 7zqd:G, 7zqd:G2 |
2 | 7zqc:G | 80 | 91 | 0.8352 | 0.9500 | 0.8352 | 1.38e-46 | 7bgi:G, 7blx:G, 6jo5:G, 6jo6:G |
3 | 6ijo:G | 70 | 91 | 0.7363 | 0.9571 | 0.7363 | 1.58e-37 | 7r3k:G |
4 | 8cmo:G | 93 | 92 | 0.5604 | 0.5484 | 0.5543 | 1.15e-30 | |
5 | 6sl5:G | 101 | 96 | 0.5275 | 0.4752 | 0.5000 | 1.39e-23 | |
6 | 7yca:G | 95 | 93 | 0.4725 | 0.4526 | 0.4624 | 3.97e-20 | |
7 | 7a4p:G | 99 | 92 | 0.4505 | 0.4141 | 0.4457 | 1.96e-19 | 6zzx:G, 6zzy:G |
8 | 6l35:G | 98 | 85 | 0.4615 | 0.4286 | 0.4941 | 7.09e-19 | 8htu:G, 7ksq:G, 7kux:G, 7xqp:G |
9 | 8bcv:G | 94 | 92 | 0.4505 | 0.4362 | 0.4457 | 1.72e-18 | |
10 | 7wg5:AG | 99 | 92 | 0.4286 | 0.3939 | 0.4239 | 2.41e-18 | 7dkz:G, 8j6z:G, 8j7a:G, 8j7b:G, 5l8r:G, 7wfd:AG, 7wfe:BG, 7wg5:BG, 6yac:G, 6yez:G, 6zoo:G, 6zxs:G |
11 | 8wgh:G | 98 | 92 | 0.4066 | 0.3776 | 0.4022 | 2.92e-17 | |
12 | 5zji:G | 97 | 92 | 0.4176 | 0.3918 | 0.4130 | 8.45e-17 | |
13 | 3lw5:G | 95 | 88 | 0.3736 | 0.3579 | 0.3864 | 9.11e-16 | 6igz:G, 2o01:G, 2wsc:G, 2wse:G, 2wsf:G, 4xk8:G, 4xk8:g |
14 | 4y28:G | 91 | 87 | 0.3297 | 0.3297 | 0.3448 | 1.33e-11 | |
15 | 4rku:G | 84 | 79 | 0.3077 | 0.3333 | 0.3544 | 3.24e-09 | |
16 | 8cmo:K | 89 | 81 | 0.2967 | 0.3034 | 0.3333 | 2.69e-06 | |
17 | 7dz7:K | 86 | 50 | 0.2418 | 0.2558 | 0.4400 | 6.65e-06 | 7bgi:K, 7blx:K, 7d0j:K, 7dz8:K, 6ijj:K, 6ijo:K, 7r3k:K, 7zq9:K, 7zqc:K, 7zqd:K, 7zqd:K2 |
18 | 7a4p:K | 86 | 34 | 0.1758 | 0.1860 | 0.4706 | 5.65e-05 | 6zzx:K, 6zzy:K |
19 | 6igz:K | 80 | 82 | 0.2747 | 0.3125 | 0.3049 | 4.36e-04 | |
20 | 8htu:K | 81 | 81 | 0.2857 | 0.3210 | 0.3210 | 7.10e-04 | 7ksq:K, 7kux:K, 6l35:K, 7xqp:K |
21 | 8wgh:K | 83 | 81 | 0.2747 | 0.3012 | 0.3086 | 0.003 | |
22 | 8j6z:K | 84 | 81 | 0.2527 | 0.2738 | 0.2840 | 0.014 | 7dkz:K, 8j7b:K, 5l8r:K, 4rku:K, 6yac:K, 6yez:K, 6zoo:K, 6zxs:K |
23 | 8bcv:K | 88 | 81 | 0.2418 | 0.2500 | 0.2716 | 0.018 | 7ew6:K, 7ewk:K, 7f9o:K, 7f9o:n, 2wse:K, 5zji:K |
24 | 7wfd:AK | 65 | 27 | 0.1319 | 0.1846 | 0.4444 | 0.056 | 7wfe:BK, 7wg5:AK, 7wg5:BK |
25 | 8j7a:K | 56 | 25 | 0.1209 | 0.1964 | 0.4400 | 0.16 | |
26 | 6sl5:K | 84 | 34 | 0.1978 | 0.2143 | 0.5294 | 0.24 | |
27 | 5anr:A | 245 | 59 | 0.1758 | 0.0653 | 0.2712 | 0.85 | |
28 | 8wwu:B | 492 | 36 | 0.1319 | 0.0244 | 0.3333 | 2.1 | 8wwu:A, 8wwu:C, 8wwu:D, 8wwu:E, 8wwu:F, 8wwv:A, 8wwv:B, 8wwv:C, 8wwv:D, 8wwv:E, 8wwv:F, 8x6z:A, 8x6z:B, 8x6z:C, 8x6z:D, 8x6z:E, 8x6z:F |
29 | 7yca:K | 87 | 74 | 0.2088 | 0.2184 | 0.2568 | 3.3 | |
30 | 7zm7:A | 711 | 40 | 0.1429 | 0.0183 | 0.3250 | 4.5 | 7zmb:A, 7zmg:A |
31 | 7b2e:A | 548 | 19 | 0.1099 | 0.0182 | 0.5263 | 4.6 | 7ayg:A, 7ayg:B, 7ayg:C, 7ayg:D, 7ayg:E, 7ayg:F, 7ayg:G, 7ayg:H, 7b2e:B, 7b2e:C, 7b2e:D, 7b2e:E, 7b2e:F, 7b2e:G, 7b2e:H |
32 | 5kay:A | 201 | 20 | 0.0989 | 0.0448 | 0.4500 | 8.0 | 5kay:B |