LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAV
TANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDY
GR
The query sequence (length=162) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5gcn:A | 166 | 161 | 0.9938 | 0.9699 | 1.0000 | 4.95e-121 | 1m1d:A, 1m1d:C, 1pu9:A, 1pua:A, 1q2c:A, 1q2d:A, 1qsn:A, 1qsr:A |
2 | 5h86:A | 167 | 155 | 0.5247 | 0.5090 | 0.5484 | 1.33e-60 | 8e6o:A, 8e6o:B, 8e6o:C, 8h65:C, 8h65:D, 8h65:E, 8h65:F, 8h65:B, 8h65:A, 8h65:G, 8h65:H, 8h66:E, 8h66:C, 8h66:D, 8h66:F, 8h66:B, 8h66:A, 8h66:G, 8h66:H, 8h6c:C, 8h6c:D, 8h6c:E, 8h6c:F, 8h6c:B, 8h6c:A, 8h6c:G, 8h6c:H, 8h6d:C, 8h6d:D, 8h6d:E, 8h6d:F, 8h6d:B, 8h6d:A, 8h6d:G, 8h6d:H, 5h84:A, 5trl:C, 5trl:D, 5trl:E, 5trl:F, 5trl:B, 5trl:A, 5trl:G, 5trl:H, 1z4r:A |
3 | 1cm0:A | 162 | 139 | 0.4938 | 0.4938 | 0.5755 | 3.08e-56 | 1cm0:B, 4nsq:A, 4nsq:B, 4nsq:C, 4nsq:D |
4 | 3b8g:A | 424 | 101 | 0.1605 | 0.0613 | 0.2574 | 1.62e-04 | 3d2m:A, 3d2p:A, 3d2p:B, 4i49:A, 2r8v:A, 2r98:A |
5 | 4pv6:G | 154 | 120 | 0.1914 | 0.2013 | 0.2583 | 0.006 | 4pv6:C, 4pv6:I, 4pv6:F, 4pv6:A, 4pv6:H, 4pv6:J, 4pv6:E |
6 | 8j9f:D | 749 | 128 | 0.2099 | 0.0454 | 0.2656 | 0.66 | 8j9f:A, 8j9f:B |
7 | 7daj:B | 150 | 57 | 0.0926 | 0.1000 | 0.2632 | 1.1 | 7daj:A, 7dak:A, 7dak:B, 7dal:A, 7dal:B |
8 | 5f47:B | 152 | 91 | 0.1358 | 0.1447 | 0.2418 | 2.6 | 5f47:A, 5f48:A, 5f48:B, 5f49:A, 5f49:B, 5f49:C, 5f49:D, 5u08:A, 5u08:B, 5u08:C, 5u08:D |
9 | 5hgz:A | 211 | 69 | 0.0926 | 0.0711 | 0.2174 | 3.0 | 5hh0:A, 5hh1:A, 5icv:A, 5icv:B, 5icw:A, 5icw:B, 5icw:C, 5icw:D |
10 | 2bsw:A | 145 | 40 | 0.0741 | 0.0828 | 0.3000 | 3.6 | 2jdc:A, 2jdd:A |
11 | 1irx:B | 508 | 48 | 0.0926 | 0.0295 | 0.3125 | 5.5 | 1irx:A |
12 | 6z00:A | 156 | 75 | 0.1543 | 0.1603 | 0.3333 | 6.7 | 6yzz:A, 6z00:B |
13 | 5c88:A | 158 | 48 | 0.0679 | 0.0696 | 0.2292 | 7.1 | 6ag4:A, 6ag5:A, 5c88:B, 4lx9:A, 4r3k:A, 4r3l:A, 2x7b:A |
14 | 8iaa:B | 383 | 25 | 0.0617 | 0.0261 | 0.4000 | 7.6 | 8ia9:A, 8ia9:B, 8iaa:A |
15 | 8ofr:B | 186 | 46 | 0.0864 | 0.0753 | 0.3043 | 9.9 | 8ofr:A, 8ofr:C, 8ofr:D, 8ofr:E, 8ofr:F, 8ofr:G, 8ofr:H, 8ofr:I, 8ofr:J, 8ofr:K, 8ofr:L, 8ofr:M, 8ofr:N, 8ofr:O, 8ofr:P, 8ofr:Q, 8ofr:R, 8ofr:S, 8ofr:T, 8ofr:U, 8ofr:V, 8ofr:W, 8ofr:X |