Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
LAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELS

The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7f1t:A 423 66 0.9701 0.1537 0.9848 5.66e-41 6akx:A, 6akx:B, 6aky:A, 5d65:B, 5d65:A, 5d65:D, 4mbs:A, 4mbs:B, 5uiw:A
2 6fgp:B 68 66 0.4627 0.4559 0.4697 1.46e-21 1b3a:B, 1b3a:A, 5coy:A, 5dnf:C, 5dnf:D, 5dnf:I, 5dnf:A, 5dnf:F, 5dnf:G, 5dnf:H, 1u4l:A, 1u4m:A
3 2ra4:B 65 63 0.3881 0.4000 0.4127 2.39e-16
4 4r8i:A 68 65 0.3881 0.3824 0.4000 4.28e-13
5 2mpm:A 74 64 0.3881 0.3514 0.4062 1.46e-12
6 2hci:A 68 58 0.3134 0.3088 0.3621 4.85e-07
7 1ilp:A 71 54 0.2388 0.2254 0.2963 0.001 1ilq:A, 6xmn:A
8 2nwg:A 68 33 0.1791 0.1765 0.3636 0.008 2nwg:B, 4uai:A
9 7xbx:R 349 56 0.2388 0.0458 0.2857 0.098 7xbw:R
10 3wis:A 180 64 0.2687 0.1000 0.2812 2.7
11 5ol0:B 263 40 0.2090 0.0532 0.3500 4.3
12 5ol0:A 283 40 0.2090 0.0495 0.3500 4.3

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218