BioLiP

>protein
KYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELHPDDR
SKIA

The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1aw3:A	94	84	1.0000	0.8936	1.0000	3.99e-58	1axx:A, 2axx:A, 1b5a:A, 1b5b:A, 1bfx:A, 1blv:A, 1do9:A, 1mny:A
2	1hko:A	104	84	0.9286	0.7500	0.9286	5.13e-55	1aqa:A, 1cyo:A, 1ehb:A, 1es1:A, 1f03:A, 1f04:A, 1i5u:A, 1ib7:A, 1j0q:A, 1jex:A, 1lqx:A, 1lr6:A, 1m20:A, 1m2i:A, 1m2m:A, 1m59:A, 1nx7:A, 1sh4:A, 1u9m:A, 1u9m:B, 1u9m:C, 1u9m:D, 1u9m:E, 1u9m:F, 1u9u:A, 3x32:A, 3x33:A, 3x34:A, 3x35:A
3	2i96:A	108	83	0.9048	0.7037	0.9157	1.20e-53	4hin:A, 4hin:B, 4hin:C, 4hin:D, 2m33:A
4	3ozz:B	82	80	0.7619	0.7805	0.8000	9.44e-46
5	2i89:A	90	78	0.6786	0.6333	0.7308	2.16e-40	2i89:B, 2i89:C, 2i89:D, 1icc:A, 1icc:B, 1icc:D, 1lj0:A, 1lj0:B, 1lj0:C, 1lj0:D, 3mus:B
6	1awp:A	86	78	0.5714	0.5581	0.6154	4.22e-34	1awp:B, 1b5m:A, 1eue:A, 1eue:B, 4hil:A, 4hil:B, 1icc:C, 3mus:A
7	3ner:B	91	78	0.5833	0.5385	0.6282	1.34e-33	3ner:A
8	2ibj:A	86	82	0.5833	0.5698	0.5976	5.09e-32
9	4b8n:B	90	74	0.3690	0.3444	0.4189	4.73e-13	4b8n:A, 4b8n:C, 4b8n:D
10	1cxy:A	81	77	0.3214	0.3333	0.3506	4.72e-12
11	8tgb:A	108	76	0.2857	0.2222	0.3158	1.56e-11	8tgb:B
12	3lf5:A	87	72	0.2857	0.2759	0.3333	1.86e-11	3lf5:B
13	1kbi:A	504	51	0.2738	0.0456	0.4510	3.13e-11	1fcb:A, 1fcb:B, 1kbi:B, 1kbj:A, 1kbj:B, 3ks0:A, 3ks0:B, 1lco:A, 1lco:B, 1ldc:A, 1ltd:A, 1ltd:B, 2oz0:A, 2oz0:B, 1qcw:A, 1qcw:B, 1sze:A, 1sze:B, 1szf:A, 1szf:B, 1szg:A, 1szg:B
14	7bwh:A	88	79	0.3333	0.3182	0.3544	3.57e-11
15	1x3x:A	82	66	0.2976	0.3049	0.3788	1.39e-09	1x3x:B
16	1sox:A	463	81	0.3690	0.0670	0.3827	4.55e-08	2a9a:A, 2a9a:B, 2a9b:A, 2a9c:A, 2a9c:B, 2a9d:A, 2a9d:B, 3hbp:A, 3hbq:A, 1sox:B
17	1mj4:A	79	73	0.3095	0.3291	0.3562	4.53e-07
18	8dyu:A	2562	29	0.1310	0.0043	0.3793	2.4	8dyv:A
19	8fcy:A	2864	29	0.1310	0.0038	0.3793	2.5	8fd6:A, 8fdt:A
20	8pqw:A	2892	29	0.1310	0.0038	0.3793	2.6	8pqy:A, 8pqz:A, 8pqz:J
21	5nug:A	2920	29	0.1310	0.0038	0.3793	2.6	5nug:B
22	7z8g:A	3047	29	0.1310	0.0036	0.3793	2.9	8fdu:A, 7z8l:f
23	8ptk:f	4502	29	0.1310	0.0024	0.3793	3.5	8ptk:e
24	7z8f:e	4579	29	0.1310	0.0024	0.3793	3.6	5owo:A, 8pr2:f, 8ptk:m, 8ptk:n, 7z8f:f, 7z8f:m, 7z8f:n, 7z8h:A
25	2d2c:D	168	24	0.1310	0.0655	0.4583	4.6	2d2c:Q, 2e74:D, 2e75:D, 2e76:D, 4h0l:D, 4h13:D, 4i7z:D, 4pv1:D, 1vf5:D, 1vf5:Q
26	3ats:A	352	27	0.1310	0.0312	0.4074	5.0	3att:A
27	1k6m:A	432	48	0.1429	0.0278	0.2500	8.4	1c7z:A, 1c7z:B, 1c80:A, 1c80:B, 1c81:A, 1fbt:A, 1fbt:B, 1k6m:B, 1tip:A, 1tip:B
28	1p5j:A	319	27	0.1310	0.0345	0.4074	8.7
29	3e23:A	198	37	0.1786	0.0758	0.4054	9.4

[Back]