BioLiP

>protein
KYPPSLVSLIRELSRLPGIGPKSAQRLAFHLFEQPREDIERLASALLEAKRDLHVCPICFNITDAEKCDVCADPSRDQRT
ICVVEEPGDVIALERSGEYRGLYHVLHGVLSPMNGVGPDKLHIKPLLPRVGQGMEVILATGTTVEGDATALYLQRLLEPL
GAAISRIAYGVPVGGSLEYTDEVTLGRALTGRQTVS

The query sequence (length=196) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1vdd:A	199	196	1.0000	0.9849	1.0000	1.92e-142	4jcv:A, 4jcv:B, 2v1c:A, 2v1c:B, 1vdd:B, 1vdd:C, 1vdd:D
2	4o6o:D	199	196	0.5663	0.5578	0.5663	7.91e-80	4o6o:A, 4o6o:B, 4o6o:C, 4o6p:B, 4o6p:C, 3vdp:A, 3vdp:B, 3vdp:C, 3vdp:D, 3vdu:A, 3ve5:D, 3ve5:A
3	5zvq:A	194	195	0.5204	0.5258	0.5231	3.35e-61	8ab0:F, 8ab0:E, 8bpr:E, 8bpr:F
4	5z2v:B	197	197	0.4796	0.4772	0.4772	2.20e-50	5z2v:A
5	8ab0:D	157	194	0.4745	0.5924	0.4794	1.14e-42	8bpr:D
6	8k3f:A	190	184	0.3112	0.3211	0.3315	1.31e-31	8k3f:B, 8k3f:C, 8k3f:D
7	8fgw:C	1342	42	0.0714	0.0104	0.3333	1.0	8fh3:C
8	6nxi:A	309	100	0.1582	0.1003	0.3100	1.6	6nxj:A, 6nxj:B
9	2oo0:A	419	41	0.0714	0.0334	0.3415	3.1	5bwa:A, 7odc:A, 2on3:A, 2on3:B, 2oo0:B, 7s3f:A, 7s3f:B, 7s3g:A, 7s3g:B, 7u6p:A, 7u6p:B, 7u6u:A, 7u6u:B, 4zgy:A
10	7t7n:B	440	50	0.0867	0.0386	0.3400	4.0	8tkz:B
11	3au2:A	575	94	0.1378	0.0470	0.2872	4.7	3au6:A, 3auo:A, 3auo:B, 3b0x:A, 3b0y:A
12	1yux:B	202	25	0.0612	0.0594	0.4800	5.2	1yux:A, 1yuz:A, 1yuz:B, 1yv1:A, 1yv1:B

[Back]