KVVSTDEYVSRTSIYYYAGSSRLLAVGNPYFSIKSPNNNKKVLVPKVSGLQYRVFRVRLPDPNKFGFPDTSFYNPDTQRL
VWACVGLEIGRGQPLGVGVSGHPYLNKFDDTETSNRYPAQPGSDNRECLSMDYKQTQLCLIGCKPPTGEHWGKGVATDCP
PLELFNSIIEDGDMVDTGFGCMDFGTLQANKSDVPIDICNSTCKYPDYLKMASEPYGDSLFFFLRREQMFVRHFFNRAGK
LGEAVPDDLYIKGSGNTAVIQSSAFFPTPSGSIVTSESQLFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRSTNMTLCT
EVTKEGTYKNDNFKEYVRHVEEYDLQFVFQLCKITLTAEIMTYIHTMDSNILEDWQFEDPLNKYTFWEVNLKEKFSADLD
QFPLGRKFLLQSGL
The query sequence (length=414) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5y9e:E | 420 | 421 | 0.9976 | 0.9833 | 0.9810 | 0.0 | 5y9e:A, 5y9e:B, 5y9e:C, 5y9e:D |
2 | 5w1o:A | 427 | 427 | 0.8213 | 0.7963 | 0.7963 | 0.0 | 5w1o:C, 5w1o:D |
3 | 5w1x:A | 422 | 422 | 0.6715 | 0.6588 | 0.6588 | 0.0 | 5w1x:B, 5w1x:E, 5w1x:F, 5w1x:G, 5w1x:J, 5w1x:L, 5w1x:N |
4 | 8tj8:A | 317 | 84 | 0.0507 | 0.0662 | 0.2500 | 2.5 | |
5 | 1hge:A | 328 | 84 | 0.0531 | 0.0671 | 0.2619 | 2.6 | 1hge:C, 1hge:E, 1hgg:A, 1hgg:C, 1hgg:E, 1hgh:A, 1hgh:C, 1hgh:E, 1hgi:A, 1hgi:C, 1hgi:E, 1hgj:A, 1hgj:C, 1hgj:E, 4hmg:A, 4hmg:C, 4hmg:E, 5hmg:A, 5hmg:C, 5hmg:E |
6 | 6p9e:A | 148 | 117 | 0.0676 | 0.1892 | 0.2393 | 2.7 | |
7 | 3u48:B | 742 | 63 | 0.0435 | 0.0243 | 0.2857 | 2.8 | 3u48:A, 3u4a:B, 3u4a:A |
8 | 6bk8:P | 653 | 90 | 0.0604 | 0.0383 | 0.2778 | 3.1 | 6exn:V, 5mq0:V |
9 | 6zq4:F | 512 | 80 | 0.0556 | 0.0449 | 0.2875 | 4.6 | 6zq4:A, 6zq4:B, 6zq4:C, 6zq4:D, 6zq4:E, 6zq4:G, 6zq4:H, 6zq6:A, 6zq6:B, 6zq6:C, 6zq6:D, 6zq7:A |
10 | 5xrs:G | 321 | 84 | 0.0531 | 0.0685 | 0.2619 | 4.9 | 5xrs:A, 5xrs:C |
11 | 2olg:A | 276 | 52 | 0.0338 | 0.0507 | 0.2692 | 6.8 | |
12 | 8fnv:A | 770 | 47 | 0.0435 | 0.0234 | 0.3830 | 7.5 | 8fnv:B, 8fnv:C, 8fnv:D, 8fnv:E, 8fnv:F, 8fnv:G, 8fnv:H, 8fnv:I, 8fnv:J, 8fnv:K, 8fnv:L, 8fnw:A, 8fnw:B, 8fnw:C, 8fnw:D, 8fnw:E, 8fnw:F, 8fnw:G, 8fnw:H, 8fnw:I, 8fnw:J, 8fnw:K, 8fnw:L |
13 | 1u8v:A | 490 | 69 | 0.0483 | 0.0408 | 0.2899 | 9.5 | 1u8v:B, 1u8v:C, 1u8v:D |