BioLiP

>protein
KVMSITPREELRRHFTHWTWLMMYGIAIYFGASIITGGASFLYAKTRLPTYQQGLSLQYLVVVVGPFMIGFVFFGWSALG
VLGVINIELGALSKLLKKDLA

The query sequence (length=101) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6cxh:C	101	101	1.0000	1.0000	1.0000	3.31e-70
2	7s4l:C	231	161	1.0000	0.4372	0.6273	1.65e-55	7s4l:H, 7s4l:I
3	8oyi:C	236	146	0.5545	0.2373	0.3836	7.64e-22	8oyi:G, 8oyi:K, 7s4h:C, 7s4h:G, 7s4h:K, 7s4i:C, 7s4i:G, 7s4i:K, 7s4j:C, 7s4j:G, 7s4j:K, 7s4k:C, 7s4k:G, 7s4k:K, 8sqw:C, 8sqw:G, 8sqw:K, 8sr1:C, 8sr1:G, 8sr1:K, 8sr2:C, 8sr2:G, 8sr2:K, 8sr4:C, 8sr4:G, 8sr4:K, 7t4p:C, 7t4p:G, 7t4p:K
4	3rgb:C	213	103	0.4554	0.2160	0.4466	5.11e-20	3rgb:K, 3rgb:G
5	1yew:C	188	116	0.4356	0.2340	0.3793	1.22e-15	1yew:G, 1yew:K
6	7s4m:K	241	159	0.5248	0.2199	0.3333	2.40e-15	4pi2:C, 4pi2:G, 4pi2:K, 7s4m:G, 7s4m:C
7	4pi0:C	217	135	0.4851	0.2258	0.3630	2.48e-15	4phz:C, 4phz:G, 4phz:K, 4pi0:G, 4pi0:K, 3rfr:C, 3rfr:G, 3rfr:K
8	3chx:C	159	36	0.1881	0.1195	0.5278	2.35e-06	3chx:G, 3chx:K
9	7qoa:A	401	37	0.1485	0.0374	0.4054	5.7	7qoa:B
10	6z0p:A	242	39	0.1584	0.0661	0.4103	5.9	6z0p:B
11	7qhm:E	331	78	0.2178	0.0665	0.2821	6.3	7q21:G, 7q21:g, 7qhm:R, 7qho:E, 7qho:R

[Back]