KVLTIKSCNIHSGIGIRPHAQIELEYQGKIHKEISEGDGGYDAFMNALTKITNRLGISIPKLIDYEVRIPPGGKTDALVE
The query sequence (length=121) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
3f6h:B |
125 |
121 |
0.9917 |
0.9600 |
0.9917 |
1.94e-87 |
3f6g:B, 3f6g:A, 3f6h:A |
2 |
7wf3:C |
328 |
60 |
0.1736 |
0.0640 |
0.3500 |
0.66 |
2a79:A, 3eau:A, 3eb3:A, 3eb4:A, 6ebk:A, 6ebk:C, 6ebk:E, 6ebk:G, 6ebl:A, 6ebl:C, 6ebl:E, 6ebl:G, 7ej1:A, 7ej1:C, 7ej1:E, 7ej1:G, 7ej2:A, 7ej2:C, 7ej2:E, 7ej2:G, 1exb:A, 4jta:A, 4jta:P, 4jtc:A, 4jtc:G, 4jtd:A, 4jtd:G, 3lnm:A, 3lnm:C, 3lut:A, 1qrq:A, 1qrq:B, 1qrq:C, 1qrq:D, 2r9r:A, 2r9r:G, 7sit:A, 7sit:C, 7siz:A, 7siz:C, 7wf3:G, 7wf3:I, 7wf3:M, 7wf4:G, 7wf4:I, 7wf4:M, 7wf4:o, 5wie:A, 5wie:G, 1zsx:A |
3 |
6qud:A |
837 |
50 |
0.1570 |
0.0227 |
0.3800 |
0.85 |
|
4 |
5lv0:A |
666 |
75 |
0.1488 |
0.0270 |
0.2400 |
1.4 |
4fxy:P, 4fxy:Q, 1i1i:P, 5luz:A, 5luz:B, 5lv0:B, 2o3e:A, 8vju:A, 8vjv:A, 8vjw:A, 8vjw:B, 8vjx:A, 8vjy:A, 8vjy:C |
5 |
6ii7:A |
355 |
39 |
0.1074 |
0.0366 |
0.3333 |
2.8 |
|
6 |
7nit:D |
1253 |
50 |
0.1488 |
0.0144 |
0.3600 |
3.3 |
5dmy:A, 5dmy:B, 5dmy:C, 7nit:A, 7nit:B, 7nit:C, 7nit:E, 7nit:F, 6qub:A, 6qub:B, 6quc:A, 6quc:B |
7 |
4fm4:A |
206 |
64 |
0.1240 |
0.0728 |
0.2344 |
3.6 |
4fm4:C, 4fm4:E, 4fm4:G, 4fm4:I, 4fm4:K, 4fm4:M, 4fm4:O, 4zgd:A, 4zgd:C, 4zgd:E, 4zgd:G, 4zgd:I, 4zgd:K, 4zgd:M, 4zgd:O, 4zge:A, 4zge:C, 4zge:E, 4zge:G, 4zge:I, 4zge:K, 4zge:M, 4zge:O, 4zgj:A, 4zgj:C, 4zgj:E, 4zgj:G, 4zgj:I, 4zgj:K, 4zgj:M, 4zgj:O |
8 |
2b0t:A |
735 |
75 |
0.1736 |
0.0286 |
0.2800 |
6.7 |
3mbc:A, 3mbc:B |