KVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFHQEIEELQQENLQLKKQLE
The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gpz:A | 63 | 59 | 0.9831 | 0.9206 | 0.9831 | 5.56e-35 | 6gp7:B, 6gpz:B |
2 | 8e2c:A | 65 | 62 | 0.5593 | 0.5077 | 0.5323 | 4.80e-13 | |
3 | 6gqn:B | 62 | 55 | 0.4746 | 0.4516 | 0.5091 | 1.94e-12 | 6gqn:A |
4 | 3uw2:A | 458 | 31 | 0.2034 | 0.0262 | 0.3871 | 0.55 | |
5 | 2j22:A | 137 | 28 | 0.2034 | 0.0876 | 0.4286 | 1.6 | |
6 | 4im0:A | 619 | 30 | 0.2203 | 0.0210 | 0.4333 | 2.5 | 6bny:A, 6bod:A, 6boe:A, 6cq0:A, 6cq4:A, 6cq5:A, 4im2:A, 4im3:A, 6nt9:A, 6nt9:B, 5w5v:A |
7 | 6o8b:B | 657 | 30 | 0.2203 | 0.0198 | 0.4333 | 2.5 | 4eut:A, 4eut:B, 4euu:A, 4euu:B, 4iw0:A, 4jl9:A, 4jlc:A, 6o8b:A, 6o8c:B |
8 | 2ood:A | 463 | 28 | 0.1864 | 0.0238 | 0.3929 | 3.4 | |
9 | 8ia3:E | 111 | 24 | 0.2034 | 0.1081 | 0.5000 | 3.8 | 8ia3:A, 8ia3:B, 8ia3:F |
10 | 7mqa:SC | 229 | 19 | 0.1356 | 0.0349 | 0.4211 | 4.0 | 2ipx:A, 7se7:A, 7se8:A, 7se8:B, 7se9:A, 7se9:B, 7sea:A, 7seb:A, 7sec:A, 7sec:B, 7sed:A |
11 | 2y5b:E | 325 | 49 | 0.2712 | 0.0492 | 0.3265 | 4.7 | 3i3t:A, 3i3t:C, 3i3t:E, 3i3t:G, 3mtn:A, 3mtn:C, 2y5b:A |
12 | 6s7o:A | 656 | 17 | 0.1356 | 0.0122 | 0.4706 | 6.9 | 6ftg:5, 6fti:5, 6ftj:5, 8pn9:A |
13 | 7a73:A | 334 | 33 | 0.1864 | 0.0329 | 0.3333 | 7.1 | |
14 | 7byd:E | 238 | 49 | 0.2542 | 0.0630 | 0.3061 | 8.2 | |
15 | 7p50:A | 121 | 21 | 0.1525 | 0.0744 | 0.4286 | 8.3 | 7p50:B, 7p50:C |
16 | 6s7t:A | 706 | 17 | 0.1525 | 0.0127 | 0.5294 | 8.4 | |
17 | 3c1y:A | 349 | 29 | 0.2034 | 0.0344 | 0.4138 | 8.5 | 3c1y:B, 3c21:A, 3c21:B, 3c23:A, 3c23:B, 4yvz:A, 4yvz:B, 4yxj:A, 4yxj:B, 4yxm:A, 4yxm:B |
18 | 7yeh:A | 1020 | 33 | 0.2203 | 0.0127 | 0.3939 | 9.2 | 4ay5:A, 4ay5:B, 4ay5:C, 4ay5:D, 4ay6:A, 4ay6:B, 4ay6:C, 4ay6:D, 5c1d:A, 4cdr:A, 4cdr:B, 4cdr:C, 4cdr:D, 8cm9:A, 8cm9:B, 8cm9:D, 8cm9:C, 8fe7:A, 8fe7:C, 8fe7:E, 8fe7:G, 8fuf:A, 8fuf:C, 8fuf:E, 8fuf:G, 4gyw:C, 4gz3:C, 4gz5:A, 4gz5:B, 4gz5:C, 4gz5:D, 4gz6:A, 4gz6:B, 4gz6:C, 4gz6:D, 5hgv:C, 6ibo:A, 5lvv:A, 6ma1:A, 6ma2:A, 6ma3:A, 6ma4:A, 6ma5:A, 4n39:A, 4n3a:A, 4n3b:A, 4n3c:A, 5npr:A, 3pe3:A, 3pe3:B, 3pe3:C, 3pe3:D, 3pe4:A, 3pe4:C, 6q4m:A, 3tax:A, 3tax:C, 1w3b:A, 4xi9:A, 4xi9:B, 4xi9:C, 4xi9:D, 4xif:A, 4xif:B, 4xif:C, 4xif:D |