BioLiP

>protein
KVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVP
VQGSKYAADR

The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6a6j:A	90	90	1.0000	1.0000	1.0000	9.44e-62	6a6j:C, 6a6l:A, 6ktc:A, 6kug:A, 6lmr:A, 5yts:A, 5ytt:A, 5ytv:A, 5ytx:A
2	7f3i:A	93	89	0.9000	0.8710	0.9101	1.61e-56	7f3i:C, 7f3i:E, 7f3j:A, 7f3j:C, 7f3j:E, 7f3j:G, 7f3k:A, 7f3l:A
3	5udz:A	139	84	0.4000	0.2590	0.4286	2.82e-15	8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B
4	4a75:A	89	82	0.3889	0.3933	0.4268	1.65e-14	4a75:C, 4a75:E, 4a75:G, 4a76:A, 4a76:G, 4a76:C, 4a76:E, 4alp:A, 4alp:D
5	2es2:A	67	66	0.3222	0.4328	0.4394	2.84e-12	3pf4:B, 3pf5:B, 3pf5:A
6	7ot5:B	66	68	0.3111	0.4242	0.4118	2.43e-11
7	1c9o:A	66	66	0.3222	0.4394	0.4394	7.78e-11	1c9o:B, 2hax:A, 2hax:B
8	7oii:B	39	37	0.2000	0.4615	0.4865	7.75e-07
9	7dm1:B	334	60	0.2111	0.0569	0.3167	0.039	7dm1:A, 7dm2:A, 1pc3:A, 1pc3:B
10	5ly8:A	230	50	0.1778	0.0696	0.3200	6.1
11	3wem:A	830	42	0.1444	0.0157	0.3095	6.7	3w37:A, 3wel:A, 3wen:A, 3weo:A
12	3q4r:A	170	55	0.1556	0.0824	0.2545	7.2	3q4o:A, 3q4q:A
13	8fqc:A	168	48	0.1556	0.0833	0.2917	8.0
14	5yo9:B	366	37	0.1444	0.0355	0.3514	9.6	5yoa:B
15	2vn0:A	464	26	0.1000	0.0194	0.3462	9.9	2nnh:A, 2nnh:B, 2nni:A, 2nnj:A, 1pq2:A, 1pq2:B

[Back]