KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTF
RSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKM
QELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVAD
LRTVLTILHQA
The query sequence (length=251) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4guh:B | 265 | 251 | 0.9960 | 0.9434 | 0.9960 | 0.0 | 4gug:A, 4gug:B, 4guh:A, 4gui:A, 4gui:B, 4guj:A, 4guj:B, 4iuo:A, 4iuo:B, 3m7w:A, 3m7w:B, 3m7w:C, 3m7w:D, 3m7w:E, 3m7w:F, 3nnt:A, 3nnt:B |
2 | 8b2b:AAA | 252 | 251 | 0.7689 | 0.7659 | 0.7689 | 7.15e-145 | 8b2b:BBB, 8b2c:AAA, 4clm:B, 4cno:A, 4cno:B, 4cno:C, 4cno:D, 4cnp:A, 4cnp:B, 6h5c:A, 6h5c:B, 6h5d:A, 6h5d:B, 6h5g:A, 6h5j:A, 1l9w:A, 1l9w:B, 1l9w:C, 1l9w:D, 1qfe:A, 1qfe:B, 6sfe:A, 6sfe:B, 6sfg:A, 4uio:A |
3 | 4h3d:B | 254 | 251 | 0.5618 | 0.5551 | 0.5618 | 3.42e-101 | 4h3d:A, 4h3d:C, 4h3d:D, 3js3:A, 3js3:B, 3js3:C, 3js3:D |
4 | 8b2a:BBB | 238 | 219 | 0.2988 | 0.3151 | 0.3425 | 2.60e-35 | 8b2a:AAA, 1sfj:A, 1sfj:B, 6sfh:A, 6sfh:B |
5 | 2o7q:A | 501 | 229 | 0.2829 | 0.1417 | 0.3100 | 9.28e-21 | 6bmb:A, 6bmq:A, 2gpt:A, 2o7s:A |
6 | 6hqv:A | 1555 | 182 | 0.1713 | 0.0277 | 0.2363 | 1.70e-05 | 6hqv:B |
7 | 5wp6:A | 977 | 70 | 0.1036 | 0.0266 | 0.3714 | 0.94 | 6bqv:A, 6bqv:C, 6bqv:B, 6bqv:D, 5wp6:B, 5wp6:C, 5wp6:D |
8 | 8dek:B | 441 | 83 | 0.0956 | 0.0544 | 0.2892 | 1.0 | 8dek:A, 8df2:A, 8df2:B, 8df2:C, 8df2:D |
9 | 2wja:A | 146 | 53 | 0.0677 | 0.1164 | 0.3208 | 3.0 | 2wja:B |
10 | 3t4k:A | 268 | 53 | 0.0637 | 0.0597 | 0.3019 | 3.0 | 3t4j:A, 3t4j:B, 3t4k:B, 3t4l:A, 3t4l:B, 3t4o:A, 3t4o:B, 3t4q:A, 3t4q:B, 3t4s:A, 3t4s:B, 3t4t:A, 3t4t:B |
11 | 7tbv:A | 682 | 189 | 0.1713 | 0.0630 | 0.2275 | 3.6 | 7tbv:B, 7tbv:C, 7tbv:D |
12 | 7pup:A | 479 | 120 | 0.1315 | 0.0689 | 0.2750 | 5.6 | |
13 | 6tg9:G | 148 | 46 | 0.0518 | 0.0878 | 0.2826 | 8.3 | 6tg9:C, 6tga:G, 6tga:C |