BioLiP

>protein
KTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDMHPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTI
DQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQH

The query sequence (length=124) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4uur:A	124	124	1.0000	1.0000	1.0000	7.74e-92	4uur:B
2	2xyk:B	130	122	0.4032	0.3846	0.4098	1.88e-29	2xyk:A
3	1ux8:A	118	122	0.3468	0.3644	0.3525	2.61e-19
4	5v3u:A	131	121	0.3145	0.2977	0.3223	6.02e-19	5v3t:A, 5v3t:B, 5v3u:B, 5v3v:A, 5v3v:B
5	2bkm:A	128	123	0.3387	0.3281	0.3415	9.99e-18	2bkm:B
6	1ngk:B	127	127	0.3548	0.3465	0.3465	1.04e-13	1ngk:A, 1ngk:C, 1ngk:D, 1ngk:E, 1ngk:F, 1ngk:G, 1ngk:H, 1ngk:I, 1ngk:J, 1ngk:K, 1ngk:L, 2qrw:A, 2qrw:B, 2qrw:C, 2qrw:D, 2qrw:E, 2qrw:F, 2qrw:G, 2qrw:H, 2qrw:I, 2qrw:J, 2qrw:K, 2qrw:L
7	4uzv:A	129	99	0.2742	0.2636	0.3434	2.03e-12	2bmm:A
8	5d1v:A	121	122	0.3145	0.3223	0.3197	2.44e-11	5d1v:B
9	4c0n:A	150	53	0.1613	0.1333	0.3774	6.34e-07	4c44:A
10	4nk2:A	164	75	0.1935	0.1463	0.3200	6.26e-06	4nk1:A, 4nk1:B, 4nk2:B
11	8tls:A	116	62	0.1694	0.1810	0.3387	0.009	8tls:B, 7tt9:A, 7tt9:B, 7tt9:C, 7tt9:D, 8ugz:A, 8ugz:B, 8ugz:C, 8ugz:D, 8uzu:A, 8uzu:B, 8uzu:C, 8uzu:D, 8vij:A, 8vij:B, 8vij:C, 8vij:D, 8vsh:A, 8vsh:B, 8vsh:C, 8vsh:D, 8w3a:A, 8w3a:B, 8w3a:C, 8w3a:D
12	3aq5:A	117	66	0.1694	0.1795	0.3182	0.041	3aq5:B, 3aq6:A, 3aq6:B, 3aq7:A, 3aq7:B, 3aq8:A, 3aq8:B, 3aq9:A, 3aq9:B
13	7ddb:A	223	65	0.1371	0.0762	0.2615	0.077	7ddb:B
14	1dlw:A	116	79	0.1613	0.1724	0.2532	0.077	1uvy:A
15	1dly:A	121	52	0.1210	0.1240	0.2885	1.1	1uvx:A
16	5xmj:C	212	27	0.0968	0.0566	0.4444	2.8	5xmj:G, 5xmj:K, 5xmj:O
17	5lqw:Q	791	31	0.0968	0.0152	0.3871	3.0
18	8ebl:A	335	60	0.1371	0.0507	0.2833	3.5	6do3:A, 6do3:B, 6do4:B, 6do4:A, 6do5:B, 6do5:A, 8ebl:B, 8ebm:A, 8ebm:B, 8pif:A, 8pif:B, 8sge:A, 8sge:B, 8sgf:B, 8sgf:A, 8uxs:A, 8uxs:B
19	7dco:1	930	31	0.0968	0.0129	0.3871	3.5	6g90:O, 5gm6:G, 5nrl:O, 5zwm:1, 5zwo:1
20	4wcj:A	233	19	0.0806	0.0429	0.5263	5.0
21	1bhg:A	611	45	0.1371	0.0278	0.3778	5.6	1bhg:B, 3hn3:A, 3hn3:B, 3hn3:D, 3hn3:E
22	5o5c:B	468	28	0.0887	0.0235	0.3929	6.9	5o5c:A, 5o5c:C, 5o5c:D, 5o5c:E, 5o5c:F
23	4v6w:CV	134	23	0.0968	0.0896	0.5217	8.3	6xu6:CV, 6xu7:CV, 6xu8:CV
24	8imx:S	513	55	0.0887	0.0214	0.2000	8.4	8imy:S

[Back]