BioLiP

>protein
KTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYI
AEQIKYW

The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2h9d:D	100	93	1.0000	0.8700	0.9355	3.96e-58	2h9c:A, 2h9c:B, 2h9d:B, 2h9d:C, 3hgw:D, 3hgx:A, 3rem:A, 3rem:B, 3ret:B
2	2h9d:A	84	87	0.9540	0.9881	0.9540	6.03e-55
3	4ll2:B	224	40	0.1609	0.0625	0.3500	0.48	4oei:A, 4oei:B, 3s18:A, 3s18:B, 3v6n:A, 3v6n:B, 4yeh:A, 4yeh:B
4	7tlp:A	391	34	0.1264	0.0281	0.3235	1.4
5	3ea0:B	242	49	0.1724	0.0620	0.3061	1.5	3ea0:A
6	7tlm:A	415	34	0.1264	0.0265	0.3235	1.7	7tlp:B, 7tlp:C, 7tlp:D, 7tlp:E, 7tlp:F, 7tlq:A, 7tlq:B, 7tlr:A, 7tlr:B
7	7stm:A	801	49	0.1494	0.0162	0.2653	4.9	7stm:B, 7stn:A, 7stn:B, 7sto:B, 7sto:A
8	7mr4:C	1083	29	0.0920	0.0074	0.2759	7.3
9	3rss:A	494	33	0.1149	0.0202	0.3030	7.4	2ax3:A, 3rrb:A, 3rre:A, 3rrf:A, 3rrj:A, 3rs8:A, 3rs9:A, 3rsf:A, 3rsg:A, 3rsq:A, 3rt7:A, 3rt9:A, 3rta:A, 3rtb:A, 3rtc:A, 3rtd:A, 3rte:A, 3rtg:A, 3ru2:A, 3ru3:A
10	8b1t:C	1080	29	0.0920	0.0074	0.2759	7.5	8b1u:C, 1w36:F
11	3k70:C	1121	29	0.0920	0.0071	0.2759	7.6	3k70:F, 5ld2:C, 7mr3:C, 6sjb:C, 6sje:C, 6sjf:C, 6sjg:C, 6t2u:C, 6t2v:C, 1w36:C
12	3aib:G	844	24	0.1264	0.0130	0.4583	9.0	3aib:A, 3aib:B, 3aib:C, 3aib:D, 3aib:E, 3aib:F, 3aib:H, 3aic:A, 3aic:B, 3aic:C, 3aic:D, 3aic:E, 3aic:F, 3aic:G, 3aic:H, 3aie:A, 3aie:B, 3aie:C, 3aie:D, 3aie:E, 3aie:F, 3aie:G, 3aie:H, 8fg8:A, 8fg8:B, 8fj9:A, 8fj9:B, 8fjc:A, 8fjc:B, 8fk4:A, 8fk4:B, 8fk4:C, 8fk4:D, 8fk4:E, 8fk4:F, 8fk4:G, 8fk4:H, 8uf5:A, 8uf5:B

[Back]