KTNERPIIGVLAQDVFDPKPDRNSYIAASYVKFLESAGARVVPVMINKSEDEYSRLFKSINGVLFPGGGVSLESSGYSKA
AGIFYRLALEANSNGDYFPVWGTALGFELLTLLTSGELLLSHTNTSGIALPLDFTEDVKGSRLFKEFPEELMKSLATEPL
TENSHQWSITTENFTANKKLKKFYRVLSTNTDGYNKFVSTMEAYDFPIYATQWHPEKNAFEWTRPYIPHTPSAIKTTFYM
ANFFVNEARKNLHSFASTEEEEKALIYNYKPEYTGIQSAFEQTYFFN
The query sequence (length=287) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4l8f:D | 287 | 287 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 4l8f:B, 4l8w:I, 4l8w:G |
2 | 4wio:A | 525 | 167 | 0.1498 | 0.0819 | 0.2575 | 0.008 | 3uow:A |
3 | 7yc6:A | 183 | 159 | 0.1359 | 0.2131 | 0.2453 | 0.89 | |
4 | 2ddx:A | 324 | 44 | 0.0523 | 0.0463 | 0.3409 | 2.6 | 3vpl:A |
5 | 7x36:A | 340 | 40 | 0.0488 | 0.0412 | 0.3500 | 5.1 | 7x36:B, 7x36:C, 7x36:D |
6 | 4lrt:B | 295 | 31 | 0.0453 | 0.0441 | 0.4194 | 5.9 | 4lrs:B, 4lrt:D |
7 | 6yxx:AR | 267 | 20 | 0.0348 | 0.0375 | 0.5000 | 6.2 | 7aoi:AR, 6hiv:AR, 6hix:AR, 6yxy:AR |
8 | 6sem:B | 530 | 77 | 0.0767 | 0.0415 | 0.2857 | 6.4 | 6sem:A, 6sem:C, 6sem:D, 6sf0:B, 6sf0:A, 6sf0:C, 6sf0:D |