BioLiP

>protein
KTINIVAGGPKNLIPDLTGYTDEHTLWIGVDKGTVTLLDAGIIPVEAFGDFDSITEQERRRIEKAAPALHVYQAKDQTDL
DLALDWALEKQPDIIQIFGITGGRADHFLGNIQLLYKGVKTNIKIRLIDKQNHIQMFPPGEYDIEKDENKRYISFIPFSE
DIHELTLTGFKYPLNNCHITLGSTLCISNELIHSRGTFSFVKGILIMIRSTDL

The query sequence (length=213) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3lm8:A	214	214	1.0000	0.9953	0.9953	1.04e-156	3lm8:B, 3lm8:C, 3lm8:D
2	3mel:C	214	212	0.3427	0.3411	0.3443	2.14e-31	3mel:A, 3mel:B, 3mel:D
3	3ihk:B	208	204	0.3052	0.3125	0.3186	1.03e-19	3ihk:A, 3ihk:C
4	2f17:A	255	156	0.1972	0.1647	0.2692	7.86e-10	2f17:B, 1ig3:A, 1ig3:B
5	3s4y:A	224	148	0.1784	0.1696	0.2568	9.24e-08	3s4y:B
6	1d9y:A	309	30	0.0563	0.0388	0.4000	1.4	1o7t:A, 1o7t:B, 1o7t:C, 1o7t:D, 1o7t:E, 1o7t:F, 1o7t:G, 1o7t:H, 1o7t:I, 1r1n:A, 1r1n:B, 1r1n:C, 1r1n:D, 1r1n:E, 1r1n:F, 1r1n:G, 1r1n:H, 1r1n:I, 1xc1:A, 1xc1:B, 1xc1:C, 1xc1:D, 1xc1:E, 1xc1:F, 1xc1:G, 1xc1:H, 1xc1:I
7	6c8w:A	357	28	0.0563	0.0336	0.4286	1.9	6c85:A, 6c85:B, 6c8w:B
8	5t9c:E	263	62	0.0610	0.0494	0.2097	2.6	5t91:A, 5t9b:G
9	8dy7:H	85	55	0.0704	0.1765	0.2727	3.5	8dy9:H
10	7zvj:B	587	57	0.0798	0.0290	0.2982	3.8	7zvj:A
11	2ics:A	368	43	0.0704	0.0408	0.3488	4.1
12	3v0s:A	287	91	0.1268	0.0941	0.2967	5.6	3v0t:A
13	6ww7:A	927	81	0.0845	0.0194	0.2222	6.2
14	3ro0:B	209	127	0.1643	0.1675	0.2756	8.7	3ro0:A, 3ro0:C, 3ro0:D
15	2ap1:A	305	30	0.0610	0.0426	0.4333	9.1
16	5dzw:A	417	61	0.0751	0.0384	0.2623	9.9

[Back]