KSIFNEPDVDFHLKLNQQLFHIPYELLSKRIKHTQAVINKETKSLHEHTAALNQIFEDELALAKITEMIRKVDHIERFLN
TQIKSYCQILNRIKKRLEFFHELKDIKSQGTRTKLIQWYQSYTNILIGDYLTRNNPIKYHWNSGVVFLKQSQLDDLIDYD
VLLEANRISTSLLHERNLLPLISWINENKKTLTKKSSILEFQARLQEYIELNLLDDQRWSVLNDLFLSDFYSMYGISQND
PLLIYLSLGISSLKTRDCLHPDLQLFTLHSLKRKNCPVCSETFKPITQALPFAHHIQSQLFENPILLPNGNVYDSKKLKK
LAKTLKKQNLISLNPGQIMDPVDMKIFCESDSIKMYPT
The query sequence (length=358) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ns4:i | 358 | 358 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 8pmq:9 | 412 | 414 | 0.9944 | 0.8641 | 0.8599 | 0.0 | |
3 | 2m7q:A | 69 | 30 | 0.0335 | 0.1739 | 0.4000 | 0.58 | 4bmj:C, 4bmj:H, 4bmj:J, 5yt6:F, 5yt6:B, 5yt6:H |
4 | 3j1o:J | 159 | 163 | 0.0978 | 0.2201 | 0.2147 | 2.2 | 3rj1:J, 3rj1:Q, 7ui9:h, 7uif:h, 7uig:h, 7uio:Ah, 7uio:Bh |
5 | 7upn:C | 208 | 62 | 0.0447 | 0.0769 | 0.2581 | 3.9 | 7upn:F |
6 | 8b17:A | 451 | 45 | 0.0475 | 0.0377 | 0.3778 | 4.8 | 8b18:A, 8b19:A, 8b1a:A, 8b1b:A, 8b1c:A, 8b1d:A, 8b1e:A, 8b1f:A, 8b1g:A, 8b1h:A, 8b1i:A, 8b1j:A, 8b1k:A |
7 | 9bct:M | 648 | 61 | 0.0531 | 0.0293 | 0.3115 | 6.1 | 9bct:J, 9bcu:J, 9bcu:M |
8 | 4z4k:A | 282 | 27 | 0.0307 | 0.0390 | 0.4074 | 6.9 | 5aas:A, 4bmj:A, 4bmj:B, 4bmj:D, 4bmj:E, 4bmj:F, 4bmj:G, 4bmj:I, 4bmj:K, 3vht:B, 5yt6:D, 4z4k:B, 4z4m:A, 4z4m:B |
9 | 1lxy:A | 409 | 106 | 0.0615 | 0.0538 | 0.2075 | 7.6 | 1lxy:B, 1s9r:A, 1s9r:B |
10 | 3x1d:A | 381 | 29 | 0.0391 | 0.0367 | 0.4828 | 8.8 |