KSFEVVFNDPEKVYGSGERVAGRVIVEVSEVTRVKAVRILASGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEMVIMRPGN
KYEYKFGFELPQGPLGTSFKGKYGSVDYWVKAFLDRPSQPTQETKKNFEVVDLV
The query sequence (length=134) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4gej:E | 142 | 142 | 1.0000 | 0.9437 | 0.9437 | 1.32e-93 | 4gej:A, 4gej:F, 4gej:C, 4gej:J, 4gej:B, 4gej:D, 4gej:H, 4gej:I |
2 | 4r7x:A | 150 | 138 | 0.4403 | 0.3933 | 0.4275 | 1.63e-29 | 4r7x:B |
3 | 2ytt:A | 46 | 27 | 0.0672 | 0.1957 | 0.3333 | 4.8 | |
4 | 8a5q:U | 606 | 60 | 0.1194 | 0.0264 | 0.2667 | 5.7 | 8a5d:U, 8a5p:U |
5 | 7y1u:A | 723 | 63 | 0.1343 | 0.0249 | 0.2857 | 6.5 | |
6 | 5cyo:A | 272 | 39 | 0.1045 | 0.0515 | 0.3590 | 9.8 | 5cyo:B, 4yqf:B, 4yqf:A |