KSFEVVFNDPEKVYGSGERVAGRVIVEVSEVTRVKAVRILASGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENE
MVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGSVDYWVKAFLDRPSQPTQETKKNFEVVDLV
The query sequence (length=142) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4gej:E | 142 | 142 | 1.0000 | 1.0000 | 1.0000 | 3.81e-103 | 4gej:A, 4gej:F, 4gej:C, 4gej:J, 4gej:B, 4gej:D, 4gej:H, 4gej:I |
2 | 4r7x:A | 150 | 146 | 0.4155 | 0.3933 | 0.4041 | 5.94e-27 | 4r7x:B |
3 | 2ytt:A | 46 | 26 | 0.0634 | 0.1957 | 0.3462 | 4.5 | |
4 | 3qw4:C | 447 | 44 | 0.0915 | 0.0291 | 0.2955 | 4.8 | 3qw4:B |
5 | 8a5q:U | 606 | 60 | 0.1127 | 0.0264 | 0.2667 | 6.5 | 8a5d:U, 8a5p:U |
6 | 3or1:A | 435 | 52 | 0.0986 | 0.0322 | 0.2692 | 7.8 | 3or1:D, 3or2:A, 3or2:D |
7 | 5cyo:A | 272 | 39 | 0.0986 | 0.0515 | 0.3590 | 9.7 | 5cyo:B, 4yqf:B, 4yqf:A |