KSFEVVFNDPEKVYGSGERVAGRVIVEVSEVTRVKAVRILASGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDEMVIMRP
GNKYEYKFGFELPQGPLGTSGSVDYWVKAFLDRPSQPTQETKKNFEVVDLV
The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4gej:E | 142 | 142 | 1.0000 | 0.9225 | 0.9225 | 3.92e-89 | 4gej:A, 4gej:F, 4gej:C, 4gej:J, 4gej:B, 4gej:D, 4gej:H, 4gej:I |
2 | 4r7x:A | 150 | 140 | 0.4275 | 0.3733 | 0.4000 | 3.78e-23 | 4r7x:B |
3 | 9c4o:A | 661 | 66 | 0.1450 | 0.0287 | 0.2879 | 3.2 | 6v81:A |
4 | 7p43:B | 690 | 77 | 0.1527 | 0.0290 | 0.2597 | 3.3 | 7p43:A |
5 | 6sga:FA | 579 | 37 | 0.1221 | 0.0276 | 0.4324 | 5.0 | 6sgb:FA |
6 | 7y1u:A | 723 | 62 | 0.1298 | 0.0235 | 0.2742 | 8.4 | |
7 | 4eb5:A | 379 | 115 | 0.1985 | 0.0686 | 0.2261 | 9.7 | 4eb5:B, 4eb7:A, 4eb7:B, 4hvk:A, 4r5f:A |