BioLiP

>protein
KRVVVLDPGHGGIDTGAIGRNGSKEKHVVLAIAKNVRSILRNHGIDARLTRSGDTFIPLYDRVEIAHKHGADLFMSIHAD
GFTNPKAAGASVFALSNRGASSAMAKYLSERENRADEVAGKKATDKDHLLQQVLFDLVQTDTIKNSLTLGSHILKKIKPV
HKLHSRNTEQAAFVVLKSPSVPSVLVETSFITNPEEERLLGTAAFRQKIATAIAEGVISYFHWFDN

The query sequence (length=226) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8c2o:A	228	226	1.0000	0.9912	1.0000	1.28e-167	8c2o:B
2	4bin:A	348	220	0.4646	0.3017	0.4773	8.42e-67
3	8c0j:A	200	223	0.3673	0.4150	0.3722	7.90e-43	8c0j:C
4	3ne8:A	226	223	0.3894	0.3894	0.3946	9.06e-41
5	5emi:A	180	223	0.3451	0.4333	0.3498	4.12e-33
6	7rag:B	197	236	0.2788	0.3198	0.2669	6.18e-21
7	7tj4:B	176	222	0.2832	0.3636	0.2883	1.10e-19	7tj4:D
8	1jwq:A	179	222	0.2832	0.3575	0.2883	6.30e-19
9	4rn7:A	186	220	0.2743	0.3333	0.2818	1.44e-18
10	7b3n:B	170	90	0.1549	0.2059	0.3889	3.07e-15	7b3n:A, 7b3n:C, 7b3n:D, 7b3n:E
11	5j72:A	638	224	0.2699	0.0956	0.2723	7.89e-13	5j72:B
12	7ago:A	214	242	0.2345	0.2477	0.2190	1.03e-05	7agl:A
13	7agm:A	218	241	0.2566	0.2661	0.2407	1.86e-05	7agm:B
14	4m6g:A	214	241	0.2301	0.2430	0.2158	4.95e-05	4lq6:A, 4m6i:A, 4m6i:B
15	4yn2:A	281	69	0.0885	0.0712	0.2899	0.23
16	2am1:A	454	55	0.0841	0.0419	0.3455	3.1	2am2:A, 3zm5:A, 3zm6:A
17	7d58:A	1387	39	0.0531	0.0087	0.3077	3.7	7a6h:A, 7ae1:A, 7ae3:A, 7aea:A, 7fji:A, 7fjj:A, 8ity:A, 8iue:A, 8iuh:A
18	3l2n:A	376	53	0.0796	0.0479	0.3396	6.9	3l2n:B
19	4otg:A	324	62	0.0752	0.0525	0.2742	7.6
20	4oth:A	306	62	0.0752	0.0556	0.2742	7.7	4oti:A
21	5f5n:A	289	32	0.0531	0.0415	0.3750	7.9	5f5n:B
22	1xov:A	315	42	0.0575	0.0413	0.3095	8.8

[Back]