KRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQS
The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8osk:M | 316 | 57 | 1.0000 | 0.1804 | 1.0000 | 1.08e-32 | 4h10:B, 8osl:M, 8osl:O |
2 | 1am9:C | 82 | 48 | 0.3509 | 0.2439 | 0.4167 | 3.63e-06 | 1am9:D, 1am9:A, 1am9:B |
3 | 8osl:N | 290 | 46 | 0.3333 | 0.0655 | 0.4130 | 8.01e-05 | 4h10:A, 8osk:N, 8osl:P |
4 | 7d8t:A | 199 | 52 | 0.3684 | 0.1055 | 0.4038 | 4.68e-04 | 4ati:A, 4ati:B, 4atk:A, 4atk:B, 7d8t:B, 6g1l:A, 8vu0:A, 8vu0:B |
5 | 7f09:C | 67 | 36 | 0.2632 | 0.2239 | 0.4167 | 7.61e-04 | |
6 | 1a0a:A | 63 | 54 | 0.2456 | 0.2222 | 0.2593 | 0.004 | 1a0a:B |
7 | 4zpr:A | 235 | 48 | 0.2807 | 0.0681 | 0.3333 | 0.009 | |
8 | 5nj8:D | 134 | 49 | 0.2807 | 0.1194 | 0.3265 | 0.013 | |
9 | 8ow1:B | 116 | 50 | 0.2807 | 0.1379 | 0.3200 | 0.015 | 8ovw:A, 8ovw:B, 8ow0:A, 8ow0:B, 8ow1:A, 7ssa:L, 7ssa:K |
10 | 5nj8:A | 176 | 42 | 0.2807 | 0.0909 | 0.3810 | 0.031 | 5nj8:C, 5v0l:B |
11 | 7xi4:A | 283 | 55 | 0.2982 | 0.0601 | 0.3091 | 0.033 | 8g4a:A, 8g4a:B, 5nj8:B, 5sy7:A, 5v0l:A, 7xhv:A, 4zph:A, 4zpk:A |
12 | 7v7w:B | 288 | 51 | 0.2456 | 0.0486 | 0.2745 | 0.036 | |
13 | 7f2f:B | 94 | 54 | 0.2807 | 0.1702 | 0.2963 | 0.043 | 7f2f:A |
14 | 7xi3:A | 287 | 50 | 0.2807 | 0.0557 | 0.3200 | 0.098 | |
15 | 8duj:J | 3892 | 37 | 0.2105 | 0.0031 | 0.3243 | 0.18 | |
16 | 4zpk:B | 321 | 47 | 0.2456 | 0.0436 | 0.2979 | 0.75 | 8ck3:A, 8ck4:A, 8ck8:A, 6czw:A, 6d09:A, 6d0b:A, 6e3s:B, 6e3t:B, 6e3u:B, 3f1o:A, 4ghi:A, 4gs9:A, 3h7w:A, 3h82:A, 5tbm:A, 5ufp:A, 7w80:B, 6x21:A, 6x28:A, 6x2h:A, 6x37:A, 6x3d:A, 4xt2:C, 4zqd:B |
17 | 7xi3:B | 314 | 25 | 0.1930 | 0.0350 | 0.4400 | 1.1 | 7xhv:B, 7xi4:B |
18 | 3fxg:A | 407 | 16 | 0.1404 | 0.0197 | 0.5000 | 3.0 | 3fxg:B, 3fxg:C, 3fxg:D, 3fxg:E, 3fxg:F, 3fxg:G, 3fxg:H |
19 | 5eyo:C | 88 | 48 | 0.2281 | 0.1477 | 0.2708 | 4.8 | 1an2:A, 5eyo:A, 1hlo:B, 1nkp:B, 1nkp:E, 1nlw:B, 1nlw:E |
20 | 5by0:A | 465 | 39 | 0.2281 | 0.0280 | 0.3333 | 5.0 | 5f13:A, 5f13:B, 5f13:C, 3pt1:A |
21 | 1hlo:A | 80 | 49 | 0.2281 | 0.1625 | 0.2653 | 5.4 | |
22 | 8duj:D | 3865 | 29 | 0.1754 | 0.0026 | 0.3448 | 6.1 | |
23 | 8duj:G | 3933 | 29 | 0.1754 | 0.0025 | 0.3448 | 6.1 | |
24 | 8dve:G | 3944 | 29 | 0.1754 | 0.0025 | 0.3448 | 6.2 | 8dtb:A, 8dve:D, 8dve:A, 8dve:J |
25 | 3be2:A | 290 | 25 | 0.1579 | 0.0310 | 0.3600 | 8.4 | 3b8q:B, 3b8r:A, 3b8r:B, 3cjf:A, 3cp9:A, 3cp9:B, 3cpb:B, 3cpc:B, 3dtw:A, 3dtw:B, 3efl:A, 3efl:B, 5ew3:A, 5ew3:B, 2p2i:A, 2p2i:B, 2qu6:A, 2qu6:B, 1y6a:A, 1y6b:A, 1ywn:A |