BioLiP

>protein
KRRKTEKPSLSQLKSQVPYPQIIEWYDCDARYPGLLASIKCTKNVIPVPSHWQSKKEYLSGRSLLGKRPFELPDIIKKTN
IEQMRSTLPALDLDYKKLHDVFFKIGANWKPDHLLCFGDVYYENRNLFEETNWKRMVDHKRPGRISQELRAIMNLPEGQL
PPWCMKMKDIGLPTGYPDLKIAGLNWDITNLKGDVYGKIIPNHHRNYFGALISFETPEFE

The query sequence (length=220) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7dco:2	220	223	0.9227	0.9227	0.9103	1.21e-146	6g90:Q, 5gm6:H, 5nrl:Q, 5zwm:2
2	7vpx:2	187	208	0.3727	0.4385	0.3942	4.24e-39	7evo:2, 8hk1:2, 7onb:I, 7q4o:B, 7q4p:B, 6y50:8
3	8i0r:2	250	214	0.3727	0.3280	0.3832	1.61e-38	8ch6:E, 6ff4:8, 6ff7:8, 8i0p:2, 8i0s:2, 8i0t:2, 8i0u:2, 8i0v:2, 8qo9:B2, 7qtt:E, 6qx9:B2, 8qxd:B2, 8r08:B2, 8r0a:B2, 8r0b:B2
4	7dvq:2	216	202	0.3591	0.3657	0.3911	6.38e-37	7abh:T, 7abi:T, 8y7e:2, 5z56:2, 5z57:2, 5z58:2
5	7q3l:B	110	133	0.2182	0.4364	0.3609	3.84e-20
6	7s7b:F	352	99	0.1136	0.0710	0.2525	0.011	7s7b:B, 7s7c:B
7	2fna:A	352	69	0.1045	0.0653	0.3333	0.34	2fna:B
8	8hov:A	87	21	0.0500	0.1264	0.5238	3.3	8hov:C, 8hov:B, 8hov:D, 8hov:E, 8hov:F
9	7yh5:B	177	37	0.0500	0.0621	0.2973	8.2	7yh5:A, 7yh5:C, 7yh5:E, 7yh5:F
10	2zo4:A	301	69	0.0727	0.0532	0.2319	9.8
11	6ly5:S	220	55	0.0773	0.0773	0.3091	9.9	6l4t:15, 6l4u:15, 6ly5:N

[Back]