BioLiP

>protein
KRNVVGICAMDAKARSKPCRNILNRIIAEGEFEAIVFGDNMILDEAVENWPACDYLICFYSSGFPLKKAEKYVELRKPFC
VNDVVFQELLWDRRLVLNILDAIRVSTPQRLICSRDGGPKINKVLEEKLRRKFGIEITEVPTPEVKMLDEDTLSVDGKII
KKPYVEKPVYGEDHNIYIYFPKSVGGGGRKLFRKVANKSSDYDPDLCAPRTEGSFIYEEFMNVDNAEDVKVYTVGPHYSH
AETRKSPVVDGIVRRNPHGKEIRFITNLSEEEKNMASKISIAFEQPVCGFDLLRVSGQSYVIDVNGWSFVKDNNDYYDNA
ARILKQMFHVAE

The query sequence (length=332) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8e1h:A	332	332	1.0000	1.0000	1.0000	0.0	8e1i:A, 8e1j:A, 8e1j:B, 8e1s:A, 8e1s:B, 8e1t:A, 8e1t:B, 8e1v:A
2	3t99:A	327	322	0.4819	0.4893	0.4969	8.46e-102	5bya:A, 5byb:A, 5dgh:A, 5dgi:A, 8g9e:A, 4hn2:A, 6n5c:A, 4nzm:A, 4nzn:A, 4nzo:A, 4q4c:A, 4q4d:A, 3t54:A, 3t7a:A, 3t9a:A, 3t9b:A, 3t9c:A, 3t9d:A, 3t9e:A, 3t9f:A
3	4iwx:A	294	91	0.0633	0.0714	0.2308	0.29	4iwy:A, 5zct:A, 5zct:B, 5zct:C, 5zct:D, 5zct:E, 5zct:F, 5zct:G, 5zct:H, 5zk6:A
4	8tru:A	378	61	0.0542	0.0476	0.2951	0.64
5	9ey8:DA	450	82	0.0723	0.0533	0.2927	1.7	9ey5:A, 9ey6:A, 9ey7:A, 9ey8:AA, 9ey8:BA, 9ey8:CA, 5m8l:A, 5m8l:C, 5m8l:B, 5m8l:D, 5m8m:A, 5m8m:B, 5m8m:C, 5m8m:D, 5m8n:A, 5m8n:C, 5m8n:D, 5m8n:B, 5m8o:B, 5m8o:C, 5m8o:A, 5m8o:D, 5m8p:A, 5m8p:B, 5m8p:C, 5m8p:D, 5m8q:A, 5m8q:C, 5m8q:D, 5m8q:B, 5m8r:A, 5m8r:B, 5m8r:C, 5m8r:D, 5m8s:A, 5m8s:B, 5m8s:D, 5m8s:C, 5m8t:A, 5m8t:B, 5m8t:C, 5m8t:D
6	7qyr:D	293	131	0.0843	0.0956	0.2137	1.7	7qyr:A, 7qyr:B, 7qyr:C, 7qyr:E, 7qyr:F, 7qyr:G, 7qyr:H, 7qys:A, 7qys:B, 7qys:C, 7qys:D, 7qys:E, 7qys:G, 7qys:H, 7qys:J, 7qys:K, 7qys:M, 7qys:O
7	6s20:C	480	46	0.0422	0.0292	0.3043	8.5
8	8j0t:C	534	77	0.0783	0.0487	0.3377	9.1	8j0s:A, 8j0s:B, 8j0s:C, 8j0t:A, 8j0t:B, 8jr0:A, 8jr0:B, 8jr0:C

[Back]