BioLiP

>protein
KRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMM

The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7mwm:A	74	67	0.9851	0.8919	0.9851	8.50e-45	6c1a:A, 6c1a:B, 6c1a:E, 6c1a:F, 6c1t:A, 6c1t:D, 6c1u:A, 6c1u:B, 6c1u:E, 6c1u:F, 6c1v:A, 6c1v:B, 6c1v:E, 6c1v:F, 6c2f:A, 6c2f:D, 6c2f:G, 6c2f:J, 6c2f:M, 6c2f:P, 6cnp:A, 6cnp:B, 6cnq:A, 6cnq:B, 7mwk:A, 7mwk:B, 7mwm:B, 7ray:A
2	2ky8:A	70	66	0.9403	0.9000	0.9545	2.20e-42
3	6ccg:A	72	67	0.7612	0.7083	0.7612	9.31e-35	6cc8:A, 6cc8:B, 6ccg:B, 6ceu:A, 6ceu:B, 6cev:A, 6cev:B
4	1ig4:A	75	64	0.5522	0.4933	0.5781	2.25e-23	6d1t:A
5	6ogj:B	82	62	0.4776	0.3902	0.5161	1.93e-12	5bt2:A, 6c1y:A, 6c1y:B, 3c2i:A, 6ogj:A, 6ogk:A, 6yww:A
6	7fef:A	48	44	0.3433	0.4792	0.5227	1.26e-10
7	3vxv:A	65	43	0.3582	0.3692	0.5581	4.90e-09	3vxx:A, 3vyb:A, 3vyq:A, 3vyq:D
8	2moe:A	71	59	0.3881	0.3662	0.4407	9.68e-09	4lg7:A
9	7fhj:B	107	47	0.2239	0.1402	0.3191	0.002	7mwh:B, 7mwl:B
10	7s7b:F	352	35	0.2388	0.0455	0.4571	0.38	7s7b:B, 7s7c:B
11	2lvh:A	45	24	0.1791	0.2667	0.5000	1.4
12	5ktc:A	187	29	0.1642	0.0588	0.3793	1.8	5ktd:A
13	3kfu:F	447	39	0.1940	0.0291	0.3333	2.5	3kfu:I
14	7d41:A	367	36	0.2090	0.0381	0.3889	3.7	7d41:B
15	7jzw:A	427	52	0.2388	0.0375	0.3077	4.7	6b44:A, 6b45:A, 6b47:A, 6b48:A, 7ecv:A, 7ecw:A, 7elm:A, 7elm:K, 7eln:A, 7eln:X, 7eqg:B, 7jzx:A, 7jzy:A, 7jzz:A, 6ne0:A, 7t3j:A, 7t3k:A, 7t3k:a, 7t3l:A, 7t3l:a, 7taw:A, 7taw:a, 7tax:A, 5uz9:A, 6vqv:C, 6vqw:B, 6vqx:B, 7we6:A, 7we6:X, 6whi:A, 7yhs:A
16	4v61:BN	176	47	0.2239	0.0852	0.3191	5.3
17	5a0y:F	248	24	0.1493	0.0403	0.4167	6.6	5a0y:C, 5a8k:C, 5a8k:F, 7b2h:C, 7b2h:F, 5g0r:F, 5g0r:C, 1hbm:C, 1hbm:F, 1hbn:C, 1hbn:F, 1hbo:C, 1hbo:F, 1hbu:C, 1hbu:F, 3m1v:F, 3m1v:C, 3m2r:F, 3m2r:C, 3m2u:F, 3m2u:C, 3m2v:F, 3m2v:C, 3m30:F, 3m30:C, 3m32:F, 3m32:C, 1mro:F, 1mro:C, 3pot:F, 3pot:C, 7suc:c, 7suc:C, 7sxm:F, 7sxm:C
18	4coy:A	232	41	0.1940	0.0560	0.3171	6.7	4cou:A, 4cov:A, 4cow:A, 4coz:A
19	6d50:B	840	27	0.1642	0.0131	0.4074	7.5	6d50:A, 6nzg:A, 6nzg:B, 5uj6:A, 5uj6:B
20	7npa:A	618	25	0.1493	0.0162	0.4000	9.0	7npa:B, 7npa:C, 7npa:D, 7npa:E, 7npa:F, 7npa:G, 7npa:H, 7npa:I, 7npa:J, 7npa:K, 7npa:L, 7npa:M, 7npa:N, 7npa:O, 7npa:P
21	6ob5:D	151	22	0.1493	0.0662	0.4545	9.8

[Back]