KRAGSKADRPSLQIQTLQHAGTTMITVPSGGVCDLINTYARGSDEGNRHTSETLTYKIAIDYHFVADAAACRYSNTGTGV
The query sequence (length=215) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8ugq:B |
215 |
215 |
1.0000 |
1.0000 |
1.0000 |
6.20e-164 |
8ugq:A, 8ugq:C, 8ugq:D, 8ugq:E, 8ugq:F, 8ugq:G, 8ugq:H, 8ugq:I, 8ugq:J, 8ugq:K, 8uh4:A, 8uh4:B, 8uh4:C, 8uh4:D, 8uh4:E, 8uh4:F, 8uh4:R, 8uh4:G, 8uh4:H, 8uh4:Z, 8uh4:I, 8uh4:J, 8uh4:K, 8uh4:7, 8uh4:L, 8uh4:M, 8uh4:c, 8uh4:N, 8uh4:O, 8uh4:d, 8uh4:P, 8uh4:Q, 8uh4:V, 8uh4:S, 8uh4:T, 8uh4:i, 8uh4:U, 8uh4:W, 8uh4:X, 8uh4:f, 8uh4:Y, 8uh4:a, 8uh4:b, 8uh4:s, 8uh4:e, 8uh4:z, 8uh4:g, 8uh4:k, 8uh4:h, 8uh4:j, 8uh4:l, 8uh4:w, 8uh4:n, 8uh4:m, 8uh4:r, 8uh4:o, 8uh4:p, 8uh4:6, 8uh4:q, 8uh4:x, 8uh4:t, 8uh4:y, 8uh4:u, 8uh4:5, 8uh4:v, 8uh4:1, 8uh4:4, 8uh4:2, 8uh4:3, 8uh4:8 |
2 |
4v4p:AN |
122 |
67 |
0.0930 |
0.1639 |
0.2985 |
2.2 |
4v4r:BO, 4v4s:BO, 4v4t:BO |
3 |
8otz:EV |
425 |
32 |
0.0558 |
0.0282 |
0.3750 |
3.0 |
|
4 |
7w62:E |
141 |
43 |
0.0605 |
0.0922 |
0.3023 |
7.8 |
7bsm:D, 7bsm:F, 7bsm:G, 7bsm:J, 7bsm:K, 7bsm:L, 7bsm:M, 7bsm:N, 7bsm:H, 7bsm:I, 7bsn:A, 7bsn:B, 7bsn:C, 7bsn:E, 7bsn:F, 7bsn:H, 7bsn:I, 7bsn:J, 7bsn:K, 7bsn:N, 7bsn:D, 7bsn:G, 7bsn:L, 7bsn:M, 7bt8:B, 7bt8:D, 7bt8:E, 7bt9:B, 7bt9:G, 7bt9:A, 7bt9:D, 7bt9:E, 7bt9:F, 7bt9:C, 7bt9:H, 7bt9:I, 7bt9:J, 7bt9:K, 7bt9:L, 7bt9:M, 7bt9:N, 7btl:B, 7btl:A, 7btl:E, 7btl:F, 7btl:C, 7btl:G, 7btl:D, 7ded:B, 7ded:C, 7ded:F, 7ded:E, 7w62:B, 7w62:J, 7w62:G, 7w62:A, 7w62:D, 7w62:F, 7w62:C, 7w62:H, 7w62:I, 7w62:K, 7w62:L, 7w62:M, 7w62:N |