BioLiP

>protein
KQSIERITKILLDELENVRENEQIRNIINSWKPLPSPEKSSIYAVDGSRSVSRLSGTVIYFLSALAVGSGKQLRLSYANA
IKSNYGTSDQIVRMQMETLENMLGYLAYRKLEGEKRAILMDGTLTGSLVRPPVYPEDIRSLNVMRALIGESDFENLLNEF
LEKLRDHYRKVEEHLEKNGNYDSPILTDNVVEKLRKKYIDTKVIAYGSGKVKVKIPRRVIPIEVLESSRGKSVDELLQEL
DEEKVELYLGKDDIYDALHMTLSYIEYLYSIDKLLEVKNLAYIAKSFYTKTLARTLGVEIVDTALLDAVIRTLIGHEKEG
YLEIEHAVVPPKWSFPDFLLSKFRNIEKLIDKGIHLAYVRFEQGDVIYMLQSTTNIEKILPLILHHKAGGYLRPLQLAHH
GVKKEARHTLEALINALRNRDPAL

The query sequence (length=424) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3taz:B	433	434	0.9858	0.9654	0.9631	0.0	3tal:A, 3tal:B, 3taz:A
2	3es7:A	387	131	0.0873	0.0956	0.2824	0.64	3es7:B, 3es8:A, 3es8:B, 3es8:C, 3es8:D, 3es8:E, 3es8:F, 3es8:G, 3es8:H, 3fyy:A, 3fyy:B, 3hpf:A, 3hpf:B, 2oqy:A, 2oqy:B, 2oqy:C, 2oqy:D, 2oqy:E, 2oqy:F, 2oqy:G, 2oqy:H
3	5lmx:B	1115	210	0.1203	0.0457	0.2429	0.65
4	5m5w:B	1183	210	0.1203	0.0431	0.2429	0.73	4c2m:B, 4c2m:Q, 4c3h:B, 4c3i:B, 4c3j:B, 5g5l:B, 6h67:B, 6h68:B, 6hko:B, 6hlq:B, 6hlr:B, 5m3f:B, 5m3m:B, 5m5x:B, 5m5y:B, 5m64:B, 5n5y:B, 5n5z:B, 5n60:B, 5n61:B, 5oa1:B, 6rqh:B, 6rql:B, 6rqt:B, 6rrd:B, 6rui:B, 6ruo:B, 6rwe:B, 6tps:B, 5w5y:B, 5w64:B, 5w65:B, 5w66:B, 4ym7:AB, 4ym7:BB, 4ym7:CB, 4ym7:DB, 4ym7:EB, 4ym7:FB
5	6rax:4	626	56	0.0401	0.0272	0.3036	1.3	6raw:4, 6ray:4, 6raz:4
6	2p2v:A	275	31	0.0330	0.0509	0.4516	2.7
7	5zns:A	381	72	0.0472	0.0525	0.2778	4.0	5znt:A
8	1b87:A	181	83	0.0637	0.1492	0.3253	4.5	2a4n:A, 2a4n:B, 1n71:A, 1n71:B, 1n71:C, 1n71:D
9	1uzn:A	239	26	0.0307	0.0544	0.5000	5.2
10	2dby:A	355	92	0.0590	0.0704	0.2717	5.9
11	3a35:A	184	49	0.0401	0.0924	0.3469	9.7	3a35:B, 3a3b:B, 3a3b:A, 3a3g:A, 3a3g:B

[Back]