KQFLSENINFSNLMRKNEVAGFKSITDFVQWENSVRLIGVSLFPVNYDNIEFMGIRLELFDELSLKYDPPFYVILKPSVK
RLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMKFANLCYKDLLKVHSRVQFFRKLEGNYVNDKQYSLLHIDNMGL
NVSFRLGADIIKIKVDDGDDEIIDCTFNGEKNISLLGSIYGITNRFQSIIM
The query sequence (length=211) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3zxu:A | 211 | 211 | 1.0000 | 1.0000 | 1.0000 | 4.09e-156 | 5mu3:A, 5mu3:D, 3zxu:C |
2 | 3tqp:A | 418 | 140 | 0.1801 | 0.0909 | 0.2714 | 0.033 | 3tqp:B |
3 | 3ubt:Y | 328 | 99 | 0.1232 | 0.0793 | 0.2626 | 1.2 | 1dct:A, 1dct:B, 3ubt:B, 3ubt:A |
4 | 8cs9:g | 832 | 40 | 0.0664 | 0.0168 | 0.3500 | 1.4 | 8cs9:V, 8cs9:e, 8cs9:Y, 8cs9:f, 8cs9:Z, 8cte:P, 8cte:T, 7v0k:O, 7v0k:P |
5 | 7tvz:A | 850 | 40 | 0.0664 | 0.0165 | 0.3500 | 1.4 | 8crq:C, 8crq:E, 8crr:C, 8crr:E, 8crt:C, 8crt:E, 8ct3:C, 8ct3:E, 8t3r:B, 8t44:B, 8t47:B, 8t47:A, 8t6u:A, 8t6u:B, 8t6v:A, 8t6v:B, 7tvz:B, 7ty4:A, 7ty4:B, 7ty6:A, 7ty6:B, 7ty7:A, 7ty7:B, 7ty8:A, 7ty8:B, 7tya:A, 7tya:B, 7uz3:C, 7uz3:E, 7v07:C, 7v07:E, 7v19:C, 7v19:E |
6 | 4yzf:A | 475 | 65 | 0.0900 | 0.0400 | 0.2923 | 4.3 | 4yzf:B, 4yzf:C, 4yzf:D |
7 | 8t45:A | 460 | 65 | 0.0900 | 0.0413 | 0.2923 | 4.4 | 8t3r:A, 8t3u:A, 8t3u:B, 8t44:A, 8t45:B |