KQAILYVGHGSRVKKAQQEAAAFLEGCKAHISVPVQEISFLELQEPTIETGFEACVKQGATHIAVVPLLLLTAAHAKHDI
PEEIVRVASRYPSVRISYGKPIGIDEEVVKAVYHRMKDIGVPYENARVVLIGRGSSDPDVKRDVTGIANLLQEMVPVKEV
IPCFLTACGPNYKEVFSELEKDDGITTFIVPYLLFTGMLMNEIEREVQKLKAHNPNVYLSSYIGFHPHVKNAFLNRVRET
AANSEGQFDFDGGS
The query sequence (length=254) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5zt7:A | 254 | 254 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 6jv6:A, 5zt7:B, 5zta:A, 5zta:B |
2 | 6m29:A | 122 | 105 | 0.1378 | 0.2869 | 0.3333 | 4.93e-12 | 8i57:A, 8i57:B, 8i58:A, 8i58:B, 6m27:A, 6m27:B, 6m28:A, 6m28:B, 6m29:B, 6m2e:A, 6m2e:B, 6m2f:A, 6m2f:B, 6m2g:A, 6m2g:B, 6m2h:A, 6m2h:B |
3 | 7dyr:Z | 274 | 106 | 0.0984 | 0.0912 | 0.2358 | 3.0 | 7dyr:C, 7dyr:F, 6k1h:Z, 6k1h:F, 6k1h:C |
4 | 8ow1:B | 116 | 66 | 0.0630 | 0.1379 | 0.2424 | 3.1 | 8ovw:A, 8ovw:B, 8ow0:A, 8ow0:B, 8ow1:A, 7ssa:L, 7ssa:K |
5 | 6rm3:LEE | 123 | 42 | 0.0591 | 0.1220 | 0.3571 | 3.7 | |
6 | 7vyx:A | 1211 | 97 | 0.1024 | 0.0215 | 0.2680 | 3.7 | 7vyx:B |
7 | 3snp:A | 850 | 89 | 0.0984 | 0.0294 | 0.2809 | 3.7 | 3sn2:A, 3snp:B |
8 | 5fg3:A | 598 | 38 | 0.0630 | 0.0268 | 0.4211 | 4.0 | 5yt0:A |
9 | 3edo:A | 151 | 69 | 0.0827 | 0.1391 | 0.3043 | 4.2 | 3edo:B |
10 | 3exe:A | 363 | 55 | 0.0709 | 0.0496 | 0.3273 | 4.7 | 6cfo:A, 6cfo:C, 3exe:C, 3exe:E, 3exe:G, 3exf:A, 3exf:C, 3exf:E, 3exf:G, 3exh:A, 3exh:C, 3exh:G, 1ni4:C, 1ni4:A, 2ozl:A, 2ozl:C |
11 | 8wch:A | 396 | 42 | 0.0630 | 0.0404 | 0.3810 | 4.8 | 8wch:B |
12 | 2b3x:A | 888 | 89 | 0.0945 | 0.0270 | 0.2697 | 5.3 | 2b3y:A, 2b3y:B |
13 | 6cxt:B | 372 | 40 | 0.0591 | 0.0403 | 0.3750 | 5.6 | 6cy8:B |
14 | 5d9b:A | 307 | 71 | 0.0709 | 0.0586 | 0.2535 | 9.4 | 5d9c:A, 5d9d:A, 5gtq:A, 5gx1:A, 5gx2:A, 5gx3:A, 5gx4:A, 5gx5:A, 5xfe:A |
15 | 1fuj:A | 221 | 29 | 0.0512 | 0.0588 | 0.4483 | 9.5 | 1fuj:B, 1fuj:C, 1fuj:D |