KPYSSPPTNLRSLRDRLTQVAERQGVVFGRLQRHVAMIVVAQFAATLTDDTGAPLLLVKGGSSLELRRGIPDSRTAKDFD
The query sequence (length=290) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
6j7n:A |
290 |
290 |
0.9931 |
0.9931 |
0.9931 |
0.0 |
6j7o:A, 6j7p:A, 6j7q:A, 6j7r:A, 6j7s:A, 6j7t:A, 8xhr:A, 8xhr:B, 8xhr:C |
2 |
5a9y:A |
562 |
28 |
0.0414 |
0.0214 |
0.4286 |
0.78 |
5a9x:A |
3 |
5epo:A |
261 |
98 |
0.0862 |
0.0958 |
0.2551 |
1.1 |
5epo:B, 5epo:C, 5epo:D |
4 |
4dyu:H |
157 |
32 |
0.0379 |
0.0701 |
0.3438 |
3.4 |
4dyu:A, 4dyu:B, 4dyu:C, 4dyu:D, 4dyu:E, 4dyu:F, 4dyu:I, 4dyu:J, 4dyu:K, 4dyu:L |
5 |
3fq7:A |
427 |
88 |
0.0724 |
0.0492 |
0.2386 |
4.0 |
3fq7:B, 3fq8:A, 3fq8:B, 3fqa:A, 3fqa:B, 2gsa:A, 2gsa:B, 3gsb:A, 3gsb:B, 4gsa:A, 4gsa:B, 2hoz:A, 2hoz:B, 2hp1:A, 2hp2:A, 2hp2:B, 3usf:A |
6 |
6cp3:C |
508 |
32 |
0.0517 |
0.0295 |
0.4688 |
4.9 |
4b2q:A, 4b2q:B, 4b2q:C, 4b2q:a, 4b2q:b, 4b2q:c, 6b8h:K, 6b8h:B, 6b8h:C, 6b8h:n, 6b8h:W, 6b8h:X, 6cp3:A, 6cp3:B, 6cp6:A, 6cp6:B, 6cp6:C, 8f29:A, 8f29:B, 8f29:C, 8f2k:A, 8f2k:B, 8f2k:C, 8f39:A, 8f39:B, 8f39:C, 8fl8:A, 8fl8:B, 8fl8:C, 2hld:A, 2hld:B, 2hld:C, 2hld:J, 2hld:K, 2hld:L, 2hld:S, 2hld:T, 2hld:U, 7md2:A, 7md2:C, 7md3:A, 7md3:B, 7md3:C, 3oe7:A, 3oe7:B, 3oe7:C, 3oe7:J, 3oe7:K, 3oe7:L, 3oe7:S, 3oe7:T, 3oe7:U, 3oee:A, 3oee:B, 3oee:C, 3oee:J, 3oee:K, 3oee:L, 3oee:S, 3oee:T, 3oee:U, 3oeh:A, 3oeh:B, 3oeh:C, 3oeh:J, 3oeh:K, 3oeh:L, 3oeh:S, 3oeh:T, 3oeh:U, 3ofn:A, 3ofn:B, 3ofn:C, 3ofn:J, 3ofn:K, 3ofn:L, 3ofn:S, 3ofn:T, 3ofn:U, 7tjs:A, 7tjs:B, 7tjs:C, 7tjt:A, 7tjt:B, 7tjt:C, 7tju:A, 7tju:B, 7tju:C, 7tjv:A, 7tjv:B, 7tjv:C, 7tjw:A, 7tjw:B, 7tjw:C, 7tjx:A, 7tjx:B, 7tjx:C, 2wpd:A, 2wpd:B, 2wpd:C, 2xok:A, 2xok:B, 2xok:C, 3zia:A, 3zia:B, 3zia:C, 3zia:K, 3zia:L, 3zia:M, 3zry:A, 3zry:B, 3zry:C |
7 |
4gbm:A |
283 |
47 |
0.0483 |
0.0495 |
0.2979 |
5.9 |
|