KPVPTYVQDKDESTLMFSVCSLVRDQAKYDRLLESFERFGFTPDKAEFLAADNREGNQFHGFSWHKQMLPRCKGRYVIFC
HEDVELVDRGYDDLVAAIEALEEADPKWLVAGVAGSPWRPLNHSVTAQALHISDVFGNDRRRGNVPCRVESLDECFLLMR
RLKPVLNSYDMQGFHYYGADLCLQAEFLGGRAYAIDFHLHHYGRAIADENFHRLRQEMAQKYRRWFPGRILHCVTGRVAL
GGGWYEAR
The query sequence (length=248) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2qgi:A | 248 | 248 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2qgi:B |
2 | 7ns3:4 | 199 | 84 | 0.0927 | 0.1156 | 0.2738 | 1.8 | |
3 | 7qep:S9 | 171 | 71 | 0.0685 | 0.0994 | 0.2394 | 2.5 | |
4 | 7xrc:C | 134 | 40 | 0.0565 | 0.1045 | 0.3500 | 6.4 | 2xsd:C |
5 | 3nj3:A | 327 | 53 | 0.0645 | 0.0489 | 0.3019 | 6.6 | 3nj3:B, 1vbr:A, 1vbr:B |
6 | 3uj2:A | 423 | 55 | 0.0524 | 0.0307 | 0.2364 | 7.3 | 3uj2:B, 3uj2:C, 3uj2:D, 3uj2:E, 3uj2:F, 3uj2:G, 3uj2:H |