BioLiP

>protein
KPVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNKFLRSVGDGETVEFDVVEGEKGAEATNVTGPG

The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7f3i:A	93	78	1.0000	0.8065	0.9615	1.01e-47	7f3i:C, 7f3i:E, 7f3j:A, 7f3j:C, 7f3j:E, 7f3j:G, 7f3k:A, 7f3l:A
2	6a6j:A	90	76	0.9200	0.7667	0.9079	3.47e-44	6a6j:C, 6a6l:A, 6ktc:A, 6kug:A, 6lmr:A, 5yts:A, 5ytt:A, 5ytv:A, 5ytx:A
3	5udz:A	139	73	0.4400	0.2374	0.4521	2.17e-14	8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B
4	4a75:A	89	73	0.4400	0.3708	0.4521	2.19e-13	4a75:C, 4a75:E, 4a75:G, 4a76:A, 4a76:G, 4a76:C, 4a76:E, 4alp:A, 4alp:D
5	2es2:A	67	63	0.3867	0.4328	0.4603	1.05e-12	3pf4:B, 3pf5:B, 3pf5:A
6	7ot5:B	66	65	0.3733	0.4242	0.4308	3.33e-12
7	1c9o:A	66	63	0.3867	0.4394	0.4603	2.25e-11	1c9o:B, 2hax:A, 2hax:B
8	7oii:B	39	36	0.2267	0.4359	0.4722	1.00e-06
9	5lj3:C	882	59	0.2400	0.0204	0.3051	0.60	6exn:C, 5gam:C, 5gan:C, 5lj5:C, 5lqw:B, 5mps:C, 5mq0:C, 5nrl:C
10	6rxd:A	509	53	0.2000	0.0295	0.2830	0.78	6rxd:B, 6rxe:A, 6rxe:B, 6rxf:A, 6rxf:B, 6rxg:A, 6rxg:B
11	7zhh:A	219	55	0.1733	0.0594	0.2364	7.7
12	8fqc:A	168	30	0.1600	0.0714	0.4000	8.6

[Back]