BioLiP

>protein
KPTITKQELYSLVAADTQLNKALIERIFTSQQKIIQNALKHNQEVIIPPGIKFTVVTVKAKPARQGHNPATGEPIQIKAK
PEHKAVKIRALKPVHDMLN

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6lmj:A	99	99	1.0000	1.0000	1.0000	9.85e-68	6lmj:B
2	4qju:A	90	99	0.3030	0.3333	0.3030	1.26e-04	4qju:B
3	8flj:G	98	74	0.2424	0.2449	0.3243	1.74e-04	8flj:E
4	5yh1:A	439	52	0.1515	0.0342	0.2885	0.007
5	1p71:A	94	76	0.2020	0.2128	0.2632	0.019	1p51:A, 1p51:B, 1p51:D, 1p51:C, 1p71:B, 1p78:A, 1p78:B
6	6o8q:B	91	89	0.2525	0.2747	0.2809	0.054	6o8q:G, 6o8q:H, 6o8q:F, 4yf0:B, 4yfh:B
7	2iie:A	204	72	0.2121	0.1029	0.2917	0.18	2ht0:A, 1ihf:A, 2iif:A, 5j0n:I, 5j0n:K, 1ouz:A, 1owf:A, 1owg:A, 5wfe:K
8	1ihf:B	94	70	0.1919	0.2021	0.2714	1.6	2ht0:B, 5j0n:J, 5j0n:L, 1ouz:B, 1owf:B, 1owg:B, 5wfe:L
9	8flj:F	94	78	0.2020	0.2128	0.2564	4.0	8flj:H
10	8eug:Q	186	26	0.1010	0.0538	0.3846	4.9	8esq:Q, 8esr:Q, 8etc:Q, 8etg:Q, 8eth:Q, 8eti:Q, 8etj:Q, 8eui:Q, 8eup:Q, 8euy:Q, 8ev3:Q
11	8y6b:D	517	26	0.1212	0.0232	0.4615	9.1	8hpy:D, 8hpy:E, 8hq0:D, 8hq0:E, 8hq0:F, 8hq1:D, 8hq1:E, 8hq1:F, 8hq2:D, 8hq2:E, 5y2z:J, 5y2z:B, 5y2z:D, 5y2z:F, 5y2z:H, 5y2z:L, 5y31:B, 5y31:D, 8y6b:F, 8y6b:E

[Back]