BioLiP

>protein
KPSLSQLKSQVPYPQIIEWYDCDARYPGLLASIKCTKNVIPVPSHWQSKKEYLSGRSLLGKRPFELPDIIKKTNIEQMRS
TLPEKSLKEASRARVQPKMGALDLDYKKLHDVFFKIGANWKPDHLLCFGDVYYENRNLFEETNWKRMVDHKRPGRISQEL
RAIMNLPEGQLPPWCMKMKDIGLPTGYPDLKIAGLNWDITNLKGDVYGKIIPRNYFGALI

The query sequence (length=220) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7dco:2	220	220	1.0000	1.0000	1.0000	1.17e-165	6g90:Q, 5gm6:H, 5nrl:Q, 5zwm:2
2	8i0r:2	250	206	0.4045	0.3560	0.4320	1.00e-47	8ch6:E, 6ff4:8, 6ff7:8, 8i0p:2, 8i0s:2, 8i0t:2, 8i0u:2, 8i0v:2, 8qo9:B2, 7qtt:E, 6qx9:B2, 8qxd:B2, 8r08:B2, 8r0a:B2, 8r0b:B2
3	7dvq:2	216	202	0.4000	0.4074	0.4356	1.27e-46	7abh:T, 7abi:T, 8y7e:2, 5z56:2, 5z57:2, 5z58:2
4	7vpx:2	187	211	0.3591	0.4225	0.3744	2.84e-36	7evo:2, 8hk1:2, 7onb:I, 7q4o:B, 7q4p:B, 6y50:8
5	7q3l:B	110	142	0.2091	0.4182	0.3239	5.76e-17
6	7s7b:F	352	99	0.1136	0.0710	0.2525	0.009	7s7b:B, 7s7c:B
7	8kdb:A	2117	139	0.1318	0.0137	0.2086	1.2	8kdc:A
8	7yh5:B	177	50	0.0636	0.0791	0.2800	2.0	7yh5:A, 7yh5:C, 7yh5:E, 7yh5:F
9	5n6u:A	811	69	0.0955	0.0259	0.3043	5.9	5n6u:B, 5n6u:C, 5n6u:D
10	2zo4:A	301	69	0.0727	0.0532	0.2319	6.5
11	6otw:B	152	60	0.0682	0.0987	0.2500	7.4	6otx:B, 6oty:B, 3pt7:B, 3pt8:B

[Back]