KPSLSQLKSQVPYPQIIEWYDCDARYPGLLASIKCTKNVIPVPSHWQSKKEYLSGRSLLGKRPFELPDIIKKTNIEQMRS
TLPEKSLKEASRARVQPKMGALDLDYKKLHDVFFKIGANWKPDHLLCFGDVYYENRNLFEETNWKRMVDHK
The query sequence (length=151) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7dco:2 | 220 | 151 | 1.0000 | 0.6864 | 1.0000 | 4.28e-111 | 6g90:Q, 5gm6:H, 5nrl:Q, 5zwm:2 |
2 | 7dvq:2 | 216 | 148 | 0.4305 | 0.3009 | 0.4392 | 2.50e-36 | 7abh:T, 7abi:T, 8y7e:2, 5z56:2, 5z57:2, 5z58:2 |
3 | 8i0r:2 | 250 | 140 | 0.4106 | 0.2480 | 0.4429 | 1.41e-35 | 8ch6:E, 6ff4:8, 6ff7:8, 8i0p:2, 8i0s:2, 8i0t:2, 8i0u:2, 8i0v:2, 8qo9:B2, 7qtt:E, 6qx9:B2, 8qxd:B2, 8r08:B2, 8r0a:B2, 8r0b:B2 |
4 | 7vpx:2 | 187 | 136 | 0.3311 | 0.2674 | 0.3676 | 2.20e-23 | 7evo:2, 8hk1:2, 7onb:I, 7q4o:B, 7q4p:B, 6y50:8 |
5 | 7q3l:B | 110 | 142 | 0.3046 | 0.4182 | 0.3239 | 1.30e-17 | |
6 | 8kdb:A | 2117 | 139 | 0.1921 | 0.0137 | 0.2086 | 0.88 | 8kdc:A |
7 | 7yh5:B | 177 | 50 | 0.0927 | 0.0791 | 0.2800 | 2.0 | 7yh5:A, 7yh5:C, 7yh5:E, 7yh5:F |
8 | 6otw:B | 152 | 60 | 0.0993 | 0.0987 | 0.2500 | 3.9 | 6otx:B, 6oty:B, 3pt7:B, 3pt8:B |
9 | 4v8m:BM | 138 | 37 | 0.0795 | 0.0870 | 0.3243 | 7.3 |