KPKFFYIKSELNGKVLDIEGQNPAPGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPK
RAWIVSGNTIAQLSDRDIVLDIIKSDKEAGAHICAWKQHGGPNQKFIIESE
The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2zqn:A | 131 | 131 | 1.0000 | 1.0000 | 1.0000 | 4.83e-95 | 2drz:A, 2drz:B, 2ds0:A, 2ds0:B, 2zqn:B, 2zqo:A, 2zqo:B |
2 | 3ah1:B | 288 | 39 | 0.1069 | 0.0486 | 0.3590 | 0.14 | 3ah1:A, 3ah4:B |
3 | 6ifb:B | 135 | 33 | 0.0992 | 0.0963 | 0.3939 | 0.38 | 6ifb:A |
4 | 4ouj:A | 281 | 58 | 0.1374 | 0.0641 | 0.3103 | 0.54 | 4ouj:B |
5 | 4owl:D | 137 | 46 | 0.1069 | 0.1022 | 0.3043 | 0.55 | 4owj:A, 4owj:B, 4owj:C, 4owj:D, 4owj:E, 4owj:F, 4owj:G, 4owk:A, 4owk:B, 4owk:C, 4owk:D, 4owk:E, 4owk:F, 4owk:G, 4owl:B, 4owl:C, 4owl:E, 4owl:F, 4owl:A, 4owl:G |
6 | 5bp5:A | 286 | 63 | 0.1374 | 0.0629 | 0.2857 | 2.2 | 5bp5:B, 5bqu:B, 5bqu:A, 4lo1:A, 4lo1:B, 4lo2:A, 4lo2:B, 4lo3:A, 4lo3:B |
7 | 3mwf:A | 292 | 25 | 0.1145 | 0.0514 | 0.6000 | 3.7 | |
8 | 1onk:B | 263 | 70 | 0.1450 | 0.0722 | 0.2714 | 3.9 | 3d7w:B, 1oql:B, 1pum:B, 1puu:B, 2r9k:B, 2rg9:B, 1sz6:B, 1tfm:B, 1yf8:B |
9 | 1knm:A | 129 | 59 | 0.1298 | 0.1318 | 0.2881 | 4.8 | 1mc9:A |
10 | 2ebs:B | 771 | 37 | 0.1069 | 0.0182 | 0.3784 | 8.6 | 2ebs:A |
11 | 4ruw:A | 386 | 60 | 0.1374 | 0.0466 | 0.3000 | 9.9 |