KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVT
PEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQRTEGVSTTDLIVRILKNYED
The query sequence (length=141) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4zcs:A | 141 | 141 | 1.0000 | 1.0000 | 1.0000 | 6.81e-104 | 7pui:A, 7pve:A, 7pvf:A, 7pvg:A, 7py9:A, 7pya:A, 7pyb:A, 7pyc:A, 7q2i:A, 7q2k:A, 7q2l:A, 7q2m:A, 7q2v:A, 7q3m:A, 7q3w:A, 7q9v:A, 7q9w:A, 7qa7:A, 7qad:A, 7qd3:A, 7qvn:A, 7qvo:A, 7z9v:A, 4zcp:A, 4zcq:A, 4zcr:A, 4zcs:C, 4zcs:E, 4zcs:B, 4zcs:D, 4zcs:F |
2 | 4mvd:B | 253 | 140 | 0.5106 | 0.2846 | 0.5143 | 5.62e-52 | 3hl4:A, 3hl4:B, 4mvc:A, 4mvc:B, 4mvd:A, 4mvd:D, 4mvd:C, 4mvd:F, 4mvd:E, 4mvd:H, 4mvd:G |
3 | 4xsv:A | 306 | 136 | 0.4043 | 0.1863 | 0.4191 | 6.59e-31 | 3elb:A |
4 | 4xsv:A | 306 | 141 | 0.3617 | 0.1667 | 0.3617 | 3.42e-19 | 3elb:A |
5 | 1coz:A | 126 | 132 | 0.3050 | 0.3413 | 0.3258 | 1.04e-11 | 1coz:B, 1n1d:A, 1n1d:B, 1n1d:C, 1n1d:D |
6 | 3glv:B | 122 | 44 | 0.1206 | 0.1393 | 0.3864 | 0.003 | |
7 | 5x3d:A | 126 | 93 | 0.1631 | 0.1825 | 0.2473 | 0.007 | |
8 | 1s4m:A | 277 | 87 | 0.1915 | 0.0975 | 0.3103 | 0.36 | 1s4m:B, 1t6x:A, 1t6x:B, 1t6y:A, 1t6y:B, 1t6z:A, 1t6z:B |
9 | 5ts2:A | 165 | 67 | 0.1277 | 0.1091 | 0.2687 | 1.4 | 4ruk:A, 4ruk:F, 4ruk:B, 4ruk:E, 4ruk:C, 4ruk:D, 5ts2:B, 5ts2:C, 5ts2:D, 5ts2:E, 5ts2:F, 3x1j:A, 3x1j:C, 3x1j:B, 3x1k:A, 3x1k:B, 3x1k:C, 3x1k:D, 3x1k:E, 3x1k:F, 3x1m:A, 3x1m:C, 3x1m:B |
10 | 1od6:A | 155 | 33 | 0.0922 | 0.0839 | 0.3939 | 3.4 | |
11 | 2dq0:A | 447 | 32 | 0.0780 | 0.0246 | 0.3438 | 3.6 | 2dq0:B, 2zr2:A, 2zr2:B |
12 | 2rvn:A | 83 | 44 | 0.1064 | 0.1807 | 0.3409 | 3.8 | |
13 | 3ial:B | 505 | 101 | 0.1631 | 0.0455 | 0.2277 | 3.9 | 3ial:A |
14 | 6gyf:B | 366 | 63 | 0.1418 | 0.0546 | 0.3175 | 4.5 | 6gye:A, 6gye:B, 6gyf:A, 6gzo:A, 6gzo:B |
15 | 3nd6:A | 152 | 60 | 0.1064 | 0.0987 | 0.2500 | 6.1 | 3nd6:B, 3nd6:C, 3nd6:D, 3nd6:E, 3nd6:F, 3nd7:A, 3nd7:B, 3nd7:C, 3nd7:D, 3nd7:E, 3nd7:F |
16 | 2dvm:A | 438 | 66 | 0.1418 | 0.0457 | 0.3030 | 6.5 | 2dvm:B, 2dvm:C, 2dvm:D |
17 | 5ti1:H | 430 | 25 | 0.0709 | 0.0233 | 0.4000 | 9.8 | 5ti1:A, 5ti1:B, 5ti1:C, 5ti1:D, 5ti1:E, 5ti1:F, 5ti1:G |