KNVIATQLSEEAQVKLEVIQSLLEPCDRTTYGQKLREAAEKLNVSLRTVQRLVKNWEQDGLVGLTQTSRADKGKHRIGEF
WENFITKTYKEGNKGSKRMTPKQVALRVEAKARELKDSKPPNYKTVLRVLAPILEKQQKAKSIRSPGWRGTTLSVKTREG
KDLSVDYSNHVWQCDHTRVDVLLVDQHGEILSRPWLTTVIDTYSRCIMGINLGFDAPSSGVVALALRHAILPKRYGSEYK
LHCEWGTYGKPEHFYTDGGKDFRSNHLSQIGAQLGFVCHLRDRPSEGGVVERPFKTLNDQLFSTLPGYTGSNVQERPEDA
EKDARLTLRELEQLLVRYIVDRYNQSIDARMGDQTRFERWEAGLPTVPVPIPERDLDICLMKQSRRTVQRGGCLQFQNLM
YRGEYLAGYAGETVNLRFDPRDITTILVYRQENNQEVFLTRAHAQ
The query sequence (length=445) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ea3:W | 514 | 445 | 1.0000 | 0.8658 | 1.0000 | 0.0 | 8aa5:AP1, 8aa5:BP1, 8ea3:X, 8ea4:W, 8ea4:X, 8rdu:R, 8rdu:S, 8rkv:R, 8rkv:S, 7svw:B, 7svw:D |
2 | 8ea3:Y | 304 | 280 | 0.5640 | 0.8257 | 0.8964 | 0.0 | 8aa5:CP1, 8aa5:DP1, 8ea3:Z, 8ea4:Z, 8ea4:Y, 8rdu:U, 8rdu:T, 8rkv:U, 8rkv:T, 7svw:A, 7svw:C |
3 | 7pik:C | 557 | 208 | 0.1281 | 0.1023 | 0.2740 | 2.64e-11 | 7pik:A, 7pik:B |
4 | 7ouf:E | 278 | 150 | 0.0854 | 0.1367 | 0.2533 | 0.058 | 7ouf:B, 7oug:E, 7oug:B, 7ouh:E, 7ouh:B, 7pel:B, 7pel:E |
5 | 7cp7:A | 430 | 35 | 0.0315 | 0.0326 | 0.4000 | 2.0 | 7cp6:A, 7cp6:B |
6 | 6skf:Av | 149 | 55 | 0.0449 | 0.1342 | 0.3636 | 6.7 | 6skg:Av, 6th6:Av, 6tmf:V |
7 | 9bh5:CW | 88 | 31 | 0.0270 | 0.1364 | 0.3871 | 6.9 | 9cai:CW |