BioLiP

>protein
KNSEMKINLRLEQFKKELVLYEQKKFKEYGMKIDEITKENKKLANEIGRLRERWDSLV

The query sequence (length=58) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5kc1:F	61	58	1.0000	0.9508	1.0000	1.11e-35	5kc1:D, 5kc1:B, 5kc1:L, 5kc1:J
2	1q4s:A	142	37	0.2586	0.1056	0.4054	0.13	1q4s:B, 1q4t:A, 1q4t:B, 1q4u:A, 1q4u:B, 3r32:A, 3r32:B, 3r34:A, 3r34:B, 3r35:A, 3r35:B, 3r37:A, 3r37:B, 3r3a:A, 3r3a:B, 3r3b:A, 3r3b:B, 3r3c:A, 3r3c:B, 3r3d:A, 3r3d:B, 3r3f:A, 3r3f:B, 3tea:A, 3tea:B
3	6ax8:A	509	41	0.2759	0.0314	0.3902	1.1	5xet:C
4	6fah:E	393	43	0.3103	0.0458	0.4186	1.1	6fah:A
5	8pz4:A	466	31	0.1552	0.0193	0.2903	1.4	7acg:A, 4afk:A, 4azl:A, 4azl:B, 4b61:A, 4b61:B, 8q2o:A, 3rbh:A, 3rbh:B, 8rqp:A, 4xnk:A, 4xnl:A
6	3fxr:A	296	20	0.1552	0.0304	0.4500	1.4	3fxu:A, 3fxu:B, 3n6u:A
7	3rbh:D	410	31	0.1552	0.0220	0.2903	1.5	3rbh:C
8	8c29:R	219	28	0.2241	0.0594	0.4643	2.6	8c29:r
9	9ax8:z	509	37	0.2069	0.0236	0.3243	3.9	3jcj:f, 3jcn:b, 5me0:W, 5me1:W, 6o7k:f, 6o9k:z
10	6fli:A	310	27	0.2241	0.0419	0.4815	4.0	6fli:B, 6fli:C, 6fli:D, 6fli:E, 6fvs:D
11	7mqa:SS	350	56	0.2586	0.0429	0.2679	7.5
12	6mve:A	680	22	0.1552	0.0132	0.4091	7.7	6cgl:A, 6cgl:B, 6cgn:A, 6mt9:A, 6mv9:A, 6mv9:B, 6mw3:D, 6mw3:C, 6myx:C, 6myx:D, 6myx:I, 6myx:J
13	1czq:A	45	27	0.1897	0.2444	0.4074	9.0	1gzl:A, 1gzl:B, 3l35:A, 3l35:C, 3l35:B, 3l36:A, 3l37:A, 3mgn:D, 3mgn:F, 3mgn:A, 3mgn:C, 3mgn:E, 3mgn:B, 6psa:A, 2q3i:A, 2r3c:A, 2r3c:B, 2r5b:A, 2r5b:C, 2r5b:B, 2r5d:A, 2r5d:C, 2r5d:B

[Back]