BioLiP

>protein
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFV
PETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYC
ESYADSMARADDSSVVYCDPPYAPLSNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKKVDELL
ALYKP

The query sequence (length=245) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4rtl:A	254	253	1.0000	0.9646	0.9684	0.0	2g1p:A, 2g1p:B, 4gbe:D, 4gbe:E, 4gbe:F, 4gol:D, 4gol:E, 4gol:F, 4gom:D, 4gom:E, 4gom:F, 4gon:D, 4gon:E, 4gon:F, 4goo:D, 4goo:E, 4goo:F, 2ore:D, 2ore:E, 2ore:F, 4rtj:A, 4rtk:A, 4rtm:A, 4rtn:A, 4rto:A, 4rtp:A, 4rtq:A, 4rtr:A, 4rts:A
2	2dpm:A	258	253	0.3143	0.2984	0.3043	2.55e-27
3	1yf3:A	259	242	0.2571	0.2432	0.2603	7.80e-18	1q0s:A, 1q0t:A, 1q0t:B, 1yf3:B, 1yfj:A, 1yfj:B, 1yfj:C, 1yfj:D, 1yfj:E, 1yfj:F, 1yfl:A, 1yfl:B, 1yfl:D, 1yfl:E
4	7m6b:A	244	219	0.2408	0.2418	0.2694	0.003	7m6b:B
5	3if2:A	437	42	0.0694	0.0389	0.4048	0.16	3if2:B
6	5o1l:A	375	96	0.1143	0.0747	0.2917	0.36	5o1l:B, 5o1m:A, 5o1m:B
7	5f15:A	541	49	0.0612	0.0277	0.3061	1.5	5ezm:A
8	8kaq:D	364	60	0.0612	0.0412	0.2500	9.0
9	8kaq:A	401	60	0.0612	0.0374	0.2500	9.5	8kaq:B, 8kaq:C

[Back]