KNLYHYHQYEITLESAVDSCKNHLQAAIGLLYSPQKCELVKLDNSGKLVDSYNRLKFNNLGVFEARFFNLNCELRWVNES
NGNGTAVLLSESDITLTGFEKGLQEFITAIDQQYLLWGEPAKHPPNADGWQRLAEARIGKLDIPLDNPLKPKDRVFLTSE
EYIAEVDDFGNCAVIDERLIKLEVK
The query sequence (length=185) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8s9t:B | 185 | 185 | 1.0000 | 1.0000 | 1.0000 | 3.52e-138 | 8s9u:B, 8s9v:B, 8s9x:B |
2 | 5djs:A | 520 | 97 | 0.1351 | 0.0481 | 0.2577 | 0.44 | 5djs:B, 5djs:C, 5djs:D |
3 | 7t7n:B | 440 | 96 | 0.1351 | 0.0568 | 0.2604 | 2.4 | 8tkz:B |
4 | 8b9d:3 | 569 | 46 | 0.0865 | 0.0281 | 0.3478 | 6.0 | |
5 | 7plo:3 | 628 | 46 | 0.0865 | 0.0255 | 0.3478 | 6.1 | 7pfo:3 |
6 | 6xtx:3 | 608 | 46 | 0.0865 | 0.0263 | 0.3478 | 6.1 | |
7 | 7w1y:B | 651 | 46 | 0.0865 | 0.0246 | 0.3478 | 6.4 | 7w1y:3 |