BioLiP

>protein
KNLSSFEKQQIEIRKQIEQLENEAVAEKKWSLKGEVKAKDRPEDALLTEELEFDRTAKPVPVITSEVTESLEDMIRRRIQ
DSNFDDLQRRTLFELSDVKSSKSLAEIYEDDYTALSEELQKAHSEISELYANLVYKLDVLSSVHFVPKPASTETPTISME
DAQPLYMSNASSLAPQEIYNVGKAEKDGEIRLKNGVAMSKEELTREDKNRLRRALKRKRSK

The query sequence (length=221) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7aju:CK	222	221	1.0000	0.9955	1.0000	2.33e-161	7d4i:5E, 7d5t:5E, 5wxm:V, 6zqd:CK, 6zqe:CK, 6zqf:CK, 6zqg:CK
2	7ajt:CK	207	227	0.9050	0.9662	0.8811	6.41e-138	7d5s:5E, 7d63:5E, 6ke6:5E, 6lqp:5E, 6lqq:5E, 6lqr:5E, 6lqs:5E, 6lqt:5E, 6lqu:5E, 6lqv:5E, 7suk:NA, 5wlc:NA, 6zqa:CK, 6zqb:CK, 6zqc:CK
3	7mqa:NA	295	201	0.3937	0.2949	0.4328	1.76e-42	7mq8:NA, 7mq9:NA
4	6rxt:CL	231	213	0.3620	0.3463	0.3756	2.71e-40	6rxu:CL, 6rxv:CL, 6rxx:CL, 6rxy:CL, 6rxz:CL
5	5oql:c	175	200	0.3213	0.4057	0.3550	1.26e-31
6	6kua:A	163	60	0.0769	0.1043	0.2833	1.1
7	8bdc:A	963	183	0.1855	0.0426	0.2240	1.8	8bdc:B, 8bdc:C, 8bdc:D
8	7znn:B	559	47	0.0588	0.0233	0.2766	2.1	7zn7:B
9	6o0z:A	1288	45	0.0633	0.0109	0.3111	3.1
10	5ij6:A	322	82	0.1041	0.0714	0.2805	6.3
11	6a9t:A	417	153	0.1719	0.0911	0.2484	6.6	6a9u:A, 6a9v:A
12	1ac0:A	108	39	0.0498	0.1019	0.2821	7.1	1acz:A
13	7s4u:A	1092	47	0.0633	0.0128	0.2979	8.4

[Back]