KNLSSFEKQQIEIRKQIEQLENEAVAEKKWSLKGEVKAKDRPEDALLTEELEFDRTAKPVPVITSEVTESLEDMIRRRIQ
DSNFDDLQRRTL
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ajt:CK | 207 | 92 | 1.0000 | 0.4444 | 1.0000 | 3.76e-61 | 7d5s:5E, 7d63:5E, 6ke6:5E, 6lqp:5E, 6lqq:5E, 6lqr:5E, 6lqs:5E, 6lqt:5E, 6lqu:5E, 6lqv:5E, 7suk:NA, 5wlc:NA, 6zqa:CK, 6zqb:CK, 6zqc:CK |
2 | 7aju:CK | 222 | 92 | 1.0000 | 0.4144 | 1.0000 | 4.35e-61 | 7d4i:5E, 7d5t:5E, 5wxm:V, 6zqd:CK, 6zqe:CK, 6zqf:CK, 6zqg:CK |
3 | 6rxt:CL | 231 | 86 | 0.4674 | 0.1861 | 0.5000 | 1.41e-25 | 6rxu:CL, 6rxv:CL, 6rxx:CL, 6rxy:CL, 6rxz:CL |
4 | 5oql:c | 175 | 85 | 0.4674 | 0.2457 | 0.5059 | 1.71e-25 | |
5 | 7mqa:NA | 295 | 87 | 0.4565 | 0.1424 | 0.4828 | 9.69e-21 | 7mq8:NA, 7mq9:NA |
6 | 6g0l:M | 855 | 36 | 0.1739 | 0.0187 | 0.4444 | 2.9 | 7nkx:W, 5o9g:W |
7 | 6ftx:W | 878 | 36 | 0.1739 | 0.0182 | 0.4444 | 3.0 | 6g0l:W, 5j70:A, 5j70:B, 3mwy:W, 3ted:A |
8 | 6zwm:E | 1117 | 33 | 0.1413 | 0.0116 | 0.3939 | 3.3 | 7pe7:F, 7pe7:E, 7pe8:E, 7pe9:E, 6zwm:F, 6zwo:F |
9 | 1z3h:A | 925 | 57 | 0.1957 | 0.0195 | 0.3158 | 9.0 | |
10 | 5cul:B | 79 | 39 | 0.1196 | 0.1392 | 0.2821 | 9.6 |