KMSFGEALEVLKQGMQVYRSGWNGKNMFLFLKSSDALASPVFGNIIFIKTADNKIHAWVPSQTDVLAEDWDIVS
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8smg:B | 76 | 76 | 1.0000 | 0.9737 | 0.9737 | 6.23e-49 | 8smf:C, 8smf:H |
2 | 8smf:E | 84 | 84 | 0.9730 | 0.8571 | 0.8571 | 1.05e-45 | 8smf:D, 8smf:F, 8smf:B, 8smf:A, 8smf:G |
3 | 8kbj:B | 104 | 102 | 0.5000 | 0.3558 | 0.3627 | 2.19e-14 | 8kbj:A, 8kbj:C, 8kbj:D, 8kbk:A, 8kbk:C, 8kbk:D, 8kbk:B, 8kbl:A, 8kbm:A, 8kbm:B, 8wjc:A, 8wjc:D, 8wjc:B, 8wjc:C |
4 | 8wjd:A | 101 | 94 | 0.4324 | 0.3168 | 0.3404 | 1.43e-13 | |
5 | 8ptk:f | 4502 | 32 | 0.1622 | 0.0027 | 0.3750 | 0.26 | 8ptk:e |
6 | 7z8f:e | 4579 | 32 | 0.1622 | 0.0026 | 0.3750 | 0.26 | 5owo:A, 8pr2:f, 8ptk:m, 8ptk:n, 7z8f:f, 7z8f:m, 7z8f:n, 7z8h:A |
7 | 7lgp:B | 377 | 31 | 0.1351 | 0.0265 | 0.3226 | 2.7 | 7lgp:A |
8 | 1gpe:B | 587 | 21 | 0.1216 | 0.0153 | 0.4286 | 3.7 | 1gpe:A |
9 | 5fw4:A | 368 | 20 | 0.1216 | 0.0245 | 0.4500 | 5.0 | 5fw4:B |
10 | 8jtz:A | 530 | 33 | 0.1757 | 0.0245 | 0.3939 | 5.4 | 8jtt:A |
11 | 6xut:A | 589 | 20 | 0.1081 | 0.0136 | 0.4000 | 5.7 | 6xuu:A, 6xuv:A |
12 | 3tlk:A | 296 | 47 | 0.1892 | 0.0473 | 0.2979 | 7.6 | 3tlk:C, 3tlk:B |
13 | 4o23:A | 376 | 29 | 0.1216 | 0.0239 | 0.3103 | 9.8 | 4o23:B, 4ppz:A, 4pqa:A, 5uej:A, 5uej:B |